DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and mars

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_956370.1 Gene:mars ZFINID:ZDB-GENE-030219-83 Length:922 Species:Danio rerio

Alignment Length:933 Identity:431/934 (46%)
Similarity:596/934 (64%) Gaps:82/934 (9%)


  Fly     1 MIIYTNDGNPLGLQLLMLAKFAKQPVQVQLVNLND--AKYKDLLVLPTLELDNGLRLFSPAAIAK 63
            |.::..:|||..|::|...:.:....:.|||...:  ..|....|||.|:|.:|..||||.:|.:
Zfish     1 MKLFIGEGNPHCLKVLAALELSGVRCETQLVKHEEKVVPYLTHPVLPILQLPSGQHLFSPNSICQ 65

  Fly    64 YLFVGKGQQ----RDEWLEWSATLLAPALAHHMAV----GHKADANALPVLNALVKKLDDKL--K 118
            |||...||:    .::||||.||.|.||:...:.:    |.:.:|.|  |:...:..|:..|  :
Zfish    66 YLFDVSGQKATDATNQWLEWEATNLQPAVLQSLQLVALQGKRVEAAA--VMKEPLSWLEQSLSKR 128

  Fly   119 ATPYLAGDKPSAADIAIWSLLAP---DGTLKGAQNVDNLRDWYGRVKALPEVQEVLAEQPLKDLS 180
            .|.:|..:..|.||:.:|:.|.|   |...:.. ::..:|.|:.||.::...|.. |.:.|:...
Zfish   129 KTSFLTDEVVSVADVVLWAALYPLLSDSAFEPG-DLQAVRGWFERVCSVSACQSA-ALRVLQGKG 191

  Fly   181 FNALQQSNRYGGLHHVPLKRLSLADASKLLVDTTPTVADT---VTNEEISAAKAAFT-----YTA 237
            ..||:...:...:.|.| :|.|.:::::        ..|:   ::.|||..|...::     :|.
Zfish   192 AEALKSFLQKQPVTHTP-RRDSPSNSTE--------AEDSERELSPEEIEEAAQVYSEGLKDFTV 247

  Fly   238 PKEIKEERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTD 302
            ..|.|  ..|||:.|:|||||||||||||||||||||||||||||::|||.|..|:|.|.|||||
Zfish   248 VTERK--HPVLPQEGKRNVLITSALPYVNNVPHLGNIIGCVLSADVFARYGRLRGWNLLYICGTD 310

  Fly   303 EYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAG 367
            ||||||||||..|.|||::|||||..:|.:||:||.|.||:|||||||.||:|.|:.|..:.:.|
Zfish   311 EYGTATENKAREEGLTPQQICDKYHCIHASIYQWFQIDFDFFGRTTTQHQTEIAQDIFWRLHERG 375

  Fly   368 YIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNS 432
            :::.::||||.|:.|.||||||||||.|||  |.:.:||||||||||:|:||.||..|:||||..
Zfish   376 FLLEDTVEQLRCEGCQRFLADRFVEGECPH--CRFPEARGDQCDKCGRLINAVELKNPQCKVCKE 438

  Fly   433 APVLRSSDQLFIDLPKAEPQLKEWVDKS--EGGWTHNAKVITRAWLKEGLKPRCITRDLKWGIPV 495
            .||:|||..||::|||.|..|::|:..|  .|.||.||:.|||:||::||||||||||||||.||
Zfish   439 TPVIRSSKHLFLNLPKLEQDLEQWLQTSTAAGDWTTNARHITRSWLRDGLKPRCITRDLKWGTPV 503

  Fly   496 PHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVL 560
            ||..:::||||||||||.||:|:|..||.::::||:..:  .|||:.|||||||||||||:|..|
Zfish   504 PHPDYKEKVFYVWFDAPIGYLSITANYTDQWERWWKNPQ--QVELYNFMAKDNVPFHSVVFPCSL 566

  Fly   561 LAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQDSSF 625
            |.....:|||::::|||||||||.|||||||:||||:.|::||||:|||||||...|||||||:|
Zfish   567 LGAQDNYTLVNNLIATEYLNYEDTKFSKSRGVGVFGDMAKDTGIPSDVWRFYLLYLRPEGQDSAF 631

  Fly   626 SWNDLAARNNSELLNNLGNFVNRALVFCEKNFSSTVPGVITTQDELVLLALINRELRGYINSMEK 690
            ||.|:|.:||||||||||||:|||.:|..|.|...||.::...|:..|:|.:..||:.||..::|
Zfish   632 SWTDMALKNNSELLNNLGNFINRAGMFVSKFFDGCVPEMLLNDDDKRLIAQVCWELKQYIQLLDK 696

  Fly   691 AKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLANLLFPYMPTT 755
            .::||.::.:|.:|||||.|:|..:||..:||..:.:.||.|:.|:.||:|||||.:|.|:|||.
Zfish   697 VRIRDALKCILNMSRHGNQYIQLNEPWKKIKGGAEDRCRAGTVTGVSVNVACLLAAVLEPFMPTV 761

  Fly   756 ARTLFGQLNAKQTPLNAEKPLVT------LLLPAGHQIGKPAPLFAKLEQSFIDELKGKYGGAQA 814
            :.::..||   |.|.::.:.:::      ..|||||:||..:|||.|||...|:.|:.::||.|.
Zfish   762 SLSIRSQL---QAPESSSRAMLSGPGAFICTLPAGHRIGTVSPLFQKLENEQIEALRKRFGGLQP 823

  Fly   815 TNDAA----------------------HSQIS-AADLEKA------VQAQADKVRELKASTKDKA 850
            ..::|                      |:..| .||.|:|      |..|.:|||.|||...:|:
Zfish   824 EEESAGLKTPSNSSVAVESKPNAGAAQHTPASVTADPERAKQLTALVAEQGEKVRALKAQKAEKS 888

  Fly   851 IWQPEVTKLLDLKKQLEEAKKKT 873
            ....||.||||||.||..|:.||
Zfish   889 AIGVEVAKLLDLKNQLCLAEGKT 911

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698 56/189 (30%)
GST_N_family 1..65 CDD:238319 22/66 (33%)
GST_C_family 63..164 CDD:295467 33/114 (29%)
PRK12268 254..812 CDD:237029 326/566 (58%)
MetRS_core 255..625 CDD:173907 241/372 (65%)
Anticodon_Ia_Met 634..763 CDD:153411 59/129 (46%)
MetRS_RNA 828..868 CDD:238475 21/46 (46%)
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
marsNP_956370.1 GstA 1..173 CDD:223698 53/175 (30%)
GST_N_family 1..67 CDD:238319 22/66 (33%)
GST_C_MetRS_N 75..176 CDD:198340 28/104 (27%)
PRK12268 261..820 CDD:237029 325/566 (57%)
MetRS_core 263..631 CDD:173907 241/372 (65%)
Anticodon_Ia_Met 640..769 CDD:153411 59/129 (46%)
MetRS_RNA 866..910 CDD:238475 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333217323
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H90878
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D279987at33208
OrthoFinder 1 1.000 FOG0004323
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127626
Panther 1 1.100 LDO PTHR45765
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.