DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and Mars2

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:XP_001066991.2 Gene:Mars2 RGDID:1311527 Length:586 Species:Rattus norvegicus

Alignment Length:604 Identity:147/605 (24%)
Similarity:234/605 (39%) Gaps:118/605 (20%)


  Fly   253 ERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSR----SAGYNTLLICGTDEYGTATENKAL 313
            |.....|:.:.|||..||:|::...:| ||...|:.|    .:| :|....||||:|...:..|.
  Rat    35 EARAYFTTPIFYVNAAPHIGHLYSALL-ADALCRHRRLRVPGSG-STRFSTGTDEHGLKIQQAAA 97

  Fly   314 AENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESV-EQL 377
            ...|.|.|:||:.......::|..||....|.|||.......||. |..||:|..::.:.: |..
  Rat    98 TAGLAPIELCDRVSAQFLQLFREAGISSTDFIRTTEARHRVAVQH-FWGVLEARGLLYKGIYEGW 161

  Fly   378 LCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVC-----NSAPVLR 437
            .|...:.||.:                            ...|..:.|....|     :..||..
  Rat   162 YCASDECFLPE----------------------------AKVTRQVGPSGDPCPVSLESGHPVSW 198

  Fly   438 SSDQLFI-DLPKAEPQLKEWVDKSEGGWTHNAKVIT--------RAWLKEGLKPRCITR---DLK 490
            :.::.:| .|.:....|:.|:       .:|.:.||        ..||:|.|....::|   .|.
  Rat   199 TKEENYIFKLSQFREPLQRWL-------RNNPQAITPEPFHQVVLQWLEEELPDLSVSRRSSHLH 256

  Fly   491 WGIPVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVV 555
            ||||||  |.:.:..|||.||...|:::......:::.|| ||..      ..:.||.:.||::.
  Rat   257 WGIPVP--GDDSQTIYVWLDALVNYLTVVGYPDADFKSWW-PATS------HIIGKDILKFHAIY 312

  Fly   556 WPSVLL--AINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARP 618
            ||::||  .:...|.:..|    .:......|.|||.|..|......:. ...|.:|::|.....
  Rat   313 WPALLLGAGLRPPHRICVH----SHWTVSGQKMSKSLGNVVDPRTCLDR-YTVDGFRYFLLRQGV 372

  Fly   619 EGQDSSFSWNDLAARNNSELLNNLGNFVNRALV-----------FCEKNFSSTVPGV------IT 666
            ...|..:....:....:|||.:.||..:||...           ||...|.|. ||:      :.
  Rat   373 PNWDCDYYDEKVVKLLDSELADALGGLLNRCTAYRINPSGTYPSFCAACFPSE-PGLMGPSVRVQ 436

  Fly   667 TQDELVL--LALINRELRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTR 729
            .:|..::  :|.:.:.:.||.|..:..|..:.|...:   |..||::|...||.|...:......
  Rat   437 AEDYALVNAVATLPKLVAGYYNDFQIYKALEAVSSCV---RQTNGFVQRHAPWKLTWESPADAPW 498

  Fly   730 ASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTL-LLPAGHQIGKPAP- 792
            ..|::.:.:....:...||.|..|..|..|..:|....|    |:.|..| .||..:  |.|.| 
  Rat   499 LGTVLHVALECLRVFGTLLQPVTPNLADKLLSRLGVSTT----ERSLGELYFLPRFY--GHPCPF 557

  Fly   793 -----------LFAKLEQS 800
                       ||.:|:||
  Rat   558 EGRKLGPDTGLLFPRLDQS 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 146/604 (24%)
MetRS_core 255..625 CDD:173907 97/394 (25%)
Anticodon_Ia_Met 634..763 CDD:153411 34/148 (23%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
Mars2XP_001066991.2 MetRS_core 37..379 CDD:173907 97/394 (25%)
PRK11893 39..574 CDD:237012 144/597 (24%)
Anticodon_Ia_Met 388..532 CDD:153411 34/148 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.