DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS and Yars1

DIOPT Version :9

Sequence 1:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001020867.2 Gene:Yars1 / 313047 RGDID:1307616 Length:564 Species:Rattus norvegicus


Alignment Length:326 Identity:68/326 - (20%)
Similarity:119/326 - (36%) Gaps:69/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   736 LCVNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTLLLPAG--HQIGKPAPLFAKLE 798
            |..::...|.|:..|:.....||.:.:...|....:...||..|....|  :|:.|...|.....
  Rat   108 LFADLHAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFTKGTDYQLSKEYTLDVYRL 172

  Fly   799 QSFIDELKGKYGGAQATNDAAHSQIS--------AADLE-KAVQAQ------------ADKVREL 842
            .|.:.:...|..||:......|..:|        |.|.| ..|.||            |:|....
  Rat   173 SSLVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPT 237

  Fly   843 KASTKDKAIWQPEVTKL-------------LDLKKQLEEAKKKTATAAAPAATPAPSNGSQS-VQ 893
            ...:|...:..|.|..|             :||..:.|:.|||...|...... ..:||..| |:
  Rat   238 LGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGN-VENNGVLSFVK 301

  Fly   894 DLEKAIQEQGDKVRKLK-GSTKDKTVWQ-------PEVNILLDLKKQLE---------------- 934
            .:...::.:...:|..| |..|..|::|       .||....|||..:|                
  Rat   302 HVLFPLKSEFVILRDEKWGGNKTYTIYQELEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNT 366

  Fly   935 -AVQKAAKAA---PAANAAPAASPAATADAAKVKALEDKIAQQAEKVRTLKATGDA-AVWKPEVD 994
             |::|.|.||   |:.....|..||.:::..::  :..::..:..|:.:::...|| :::..::|
  Rat   367 PALKKLASAAYPDPSKQKPTAKGPAKSSEPEEI--IPSRLDIRVGKILSVEKHPDADSLYVEKID 429

  Fly   995 I 995
            :
  Rat   430 V 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 16/77 (21%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411 6/26 (23%)
MetRS_RNA 828..868 CDD:238475 12/65 (18%)
MetRS_RNA 895..938 CDD:238475 13/67 (19%)
MetRS_RNA 966..1009 CDD:238475 4/31 (13%)
Yars1NP_001020867.2 nt_trans 44..364 CDD:294020 55/256 (21%)
tyrS 45..364 CDD:272976 55/256 (21%)
tRNA_bind_EMAP-II_like 401..504 CDD:239198 4/30 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.