DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and rar1

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_595586.1 Gene:rar1 PomBaseID:SPBC17A3.04c Length:782 Species:Schizosaccharomyces pombe

Alignment Length:803 Identity:332/804 (41%)
Similarity:457/804 (57%) Gaps:110/804 (14%)


  Fly    51 NGLRLFSPAAIAKYL--------FVGKGQQRDEW----------LEWSATLLAPALAHHMAVGHK 97
            |.:||.:.....||:        |:...|:.|.:          |:|.|....|..  :.|...:
pombe    44 NSVRLVNSKEPEKYVSDANAIVSFLYWKQEEDLFNSFISSKLSILDWEALQFTPKA--YTAKTKE 106

  Fly    98 ADANALPVLNALVKKLDDKLKATPYLAGDKPSAADIAIWSLLAPDGTLKGA--QNVDNLRDWYGR 160
            ..|..|..|..:.|:.:...:.||.   :...|:||...       .|.||  :....|..||.:
pombe   107 DFAYLLSQLETIFKENEILNEFTPV---EVALASDIYFC-------VLNGAPVREYPLLSAWYLK 161

  Fly   161 V-KALPEVQEVLAEQPLKDLSFNALQQSNRYGGLHHVPLKRLSLADASKLLVDTT---PTVADTV 221
            : |..|.||                                     |.||..:.|   |.|..| 
pombe   162 IEKQKPFVQ-------------------------------------ALKLTFEKTLGQPAVTST- 188

  Fly   222 TNEEISAAKAAFTYTAPKEIKEE---RTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADI 283
              |:|..::......:...::|.   ..:|||..|||:||||||||||||||||||:|..||||:
pombe   189 --EKIPVSETTRNVNSQHLMRERVPGEKILPKSNERNILITSALPYVNNVPHLGNIVGSTLSADV 251

  Fly   284 YARYSRSAGYNTLLICGTDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTT 348
            :|||.|:..:|||.||||||||||||.|||.|.::|:|:||||..||..:|.||.|.||:|||||
pombe   252 FARYHRARNHNTLYICGTDEYGTATETKALEEGVSPKELCDKYHALHKEVYDWFEIDFDHFGRTT 316

  Fly   349 TQEQTDIVQEAFKDVLKAGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKC 413
            |.:||.|.|..|..:....|:..:::.||.|:....:||||:||||||.  |||:||||||||.|
pombe   317 TPKQTGIAQHIFTKLYNNDYMAIDTMTQLYCEVHQGYLADRYVEGTCPK--CGYDDARGDQCDGC 379

  Fly   414 GKLVNATELIRPRCKVCNSAPVLRSSDQLFIDLPKAEPQLKEWVDKS--EGGWTHNAKVITRAWL 476
            |.|:||.|||.|:||:..:.||.|.:..:|:.|.|.:|.::.|..:|  ||.|::|.:.||.:||
pombe   380 GGLLNAFELIDPKCKLDRATPVKRETKHVFLSLDKLQPAVESWAMQSAVEGKWSNNGRSITESWL 444

  Fly   477 KEGLKPRCITRDLKWGIPVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELF 541
            ||||:|||||||||||.|||.|.|:.||.||||||..||:|:|..||.|:::||:..:  .|:|:
pombe   445 KEGLRPRCITRDLKWGTPVPLEEFKGKVLYVWFDATIGYISITANYTDEWEKWWRNPE--QVKLY 507

  Fly   542 QFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPA 606
            |||.|||||||:|::||.||...:..|::.||..|:|||||.||||||||:|||||.||:.|:..
pombe   508 QFMGKDNVPFHTVIFPSSLLGTGEKWTMLHHINTTDYLNYETGKFSKSRGVGVFGNTAQDIGLSP 572

  Fly   607 DVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFSSTVPGVITTQDEL 671
            .|||:||.|:|||..|:.|:|.:...|:|||||.||||||||.|.|....::..||..:|  |..
pombe   573 SVWRYYLLSSRPETSDTMFTWKEFITRHNSELLANLGNFVNRTLKFTTAKYNGLVPHYLT--DPS 635

  Fly   672 V--------LLALINRELRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDD--- 725
            |        .:..:|..|..|..::|.:|||:|:|..:.||..||.|:|..:       .|:   
pombe   636 VGAGKLKADFVKDVNALLAKYNAALEASKLREGLRLAMEISARGNQYLQDNR-------IDNKCY 693

  Fly   726 --QKTRASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTLLLPAGHQIG 788
              ::.:.:..||..:|:..|||.:.:||||:|:.:::.||||   |..|......|.|..||:||
pombe   694 LYERQKCADAIGYALNLIYLLAAIFYPYMPSTSTSIYKQLNA---PAAAIPDTWELCLLPGHRIG 755

  Fly   789 KPAPLFAKLEQSFIDELKGKYGG 811
            :|..||.::::|..:|.:.||||
pombe   756 EPEYLFTRIDESMEEEWRSKYGG 778

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698 32/145 (22%)
GST_N_family 1..65 CDD:238319 5/14 (36%)
GST_C_family 63..164 CDD:295467 26/122 (21%)
PRK12268 254..812 CDD:237029 286/574 (50%)
MetRS_core 255..625 CDD:173907 214/372 (58%)
Anticodon_Ia_Met 634..763 CDD:153411 48/142 (34%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
rar1NP_595586.1 PRK12268 222..779 CDD:237029 286/574 (50%)
MetRS_core 223..591 CDD:173907 214/372 (58%)
Anticodon_Ia_Met 600..733 CDD:153411 48/142 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H90878
Inparanoid 1 1.050 586 1.000 Inparanoid score I163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004323
OrthoInspector 1 1.000 T1124272
orthoMCL 1 0.900 OOG5_127626
Panther 1 1.100 LDO PTHR45765
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1449
TreeFam 1 0.960
109.950

Return to query results.
Submit another query.