DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and Mars

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001165053.1 Gene:Mars MGIID:1345633 Length:910 Species:Mus musculus

Alignment Length:979 Identity:453/980 (46%)
Similarity:601/980 (61%) Gaps:132/980 (13%)


  Fly     1 MIIYTNDGNPLGLQLLMLAKFAKQPVQVQLVNLNDAKYKDLLV-------LPTLELDNGLRLFSP 58
            |.::.::|:|..|.:|..|..|:...::.:..:..   ::.:|       :|.|:||:|..|||.
Mouse     1 MRLFVSEGSPGSLPVLAAAARARGRAELLISTVGP---EECVVPFLTRPKVPVLQLDSGNYLFSA 62

  Fly    59 AAIAKYLFVGKGQQRD----EWLEWSATLLAPALA---HHMAVGHKADANALPVLNALVKKLDDK 116
            :||.:|.|:..|.::|    :||||.||.|.|.|:   |.:.|..|...:.|..|..::..:|..
Mouse    63 SAICRYFFLLCGWEQDDLTNQWLEWEATELQPVLSAALHCLVVQGKKGEDILGPLRRVLTHIDHS 127

  Fly   117 L--KATPYLAGDKPSAADIAIWSLLAPDGTLKG----AQNVDNLRDWYGRVKALPEVQEVLAEQP 175
            |  :..|:||||..|.|||.:|..|.|  .|:.    .:.:..|:.|:         |.:..::|
Mouse   128 LSRQNCPFLAGDTESLADIVLWGALYP--LLQDPAYLPEELGALQSWF---------QTLSTQEP 181

  Fly   176 LKDLSFNALQQSNRYGGLHHVPLKRLSLADASKLLVDTTP----------TVAD--------TVT 222
            .:..:...|:|.   |.|            |.:|.:...|          ||::        |::
Mouse   182 CQRAAETVLKQQ---GVL------------ALRLYLQKQPQPQPPPPEGRTVSNELEEEELATLS 231

  Fly   223 NEEISAAKAAF---TYTAPKEIKEERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIY 284
            .|:|..|.||:   ..:.|....::..|||.||||||||||||||||||||||||||||||||::
Mouse   232 EEDIVTAVAAWEKGLESLPPLKLQQHPVLPVPGERNVLITSALPYVNNVPHLGNIIGCVLSADVF 296

  Fly   285 ARYSRSAGYNTLLICGTDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTT 349
            |||.|...:|||.:|||||||||||.||:.|.||||||||||..:|..|||||||.||.||||||
Mouse   297 ARYCRLRQWNTLYLCGTDEYGTATETKAMEEGLTPREICDKYHAIHADIYRWFGISFDTFGRTTT 361

  Fly   350 QEQTDIVQEAFKDVLKAGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCG 414
            .:||.|.|:.|:.:|..|:::.::||||.|::|.||||||||||.||.  ||||:|||||||:||
Mouse   362 PQQTKITQDIFQRLLTRGFVLRDTVEQLRCERCARFLADRFVEGVCPF--CGYEEARGDQCDRCG 424

  Fly   415 KLVNATELIRPRCKVCNSAPVLRSSDQLFIDLPKAEPQLKEWVDKSEGG--WTHNAKVITRAWLK 477
            ||:||.||.:|:||:|.|.||:|||..||:||||.|.:|::|:.|:..|  ||.||:.|.|:||:
Mouse   425 KLINAIELKKPQCKICRSCPVVRSSQHLFLDLPKLEKRLEDWLGKTVPGSDWTPNARFIIRSWLR 489

  Fly   478 EGLKPRCITRDLKWGIPVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQ 542
            :||||||||||||||.|||.||||.|||||||||..||||:|..||.::::||:..:  .|:|:|
Mouse   490 DGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYVSITANYTDQWEKWWKNPE--QVDLYQ 552

  Fly   543 FMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPAD 607
            ||||||||||.:|:|..:|.....:|||.||:||||||||||||||||||||||:.|::||||||
Mouse   553 FMAKDNVPFHGLVFPCSVLGAEDNYTLVKHIIATEYLNYEDGKFSKSRGIGVFGDMAKDTGIPAD 617

  Fly   608 VWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFSSTVPGVITTQDELV 672
            :|||||...|||||||:|||.||..:||||||||||||:|||.:|..|.|...||.:..|.|:..
Mouse   618 IWRFYLLYIRPEGQDSAFSWTDLLIKNNSELLNNLGNFINRAGMFVSKFFGGCVPEMALTPDDRR 682

  Fly   673 LLALINRELRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLC 737
            |:|.::.||:.|...:||.::||.:|.:|.||||||.|:|..:||..:||.:..:.||.|:.|:.
Mouse   683 LVAHVSWELQHYHQLLEKVRIRDALRSILTISRHGNQYIQVNEPWKRIKGGEMDRQRAGTVTGMA 747

  Fly   738 VNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVT---LLLPAGHQIGKPAPLFAKLEQ 799
            ||:|.||:.:|.|||||.:.|:..||   |.|..|.:.|.|   ..|||||:||..:|||.|||.
Mouse   748 VNMAALLSVMLQPYMPTVSSTIQTQL---QLPPAACRILATSFICTLPAGHRIGTVSPLFQKLEN 809

  Fly   800 SFIDELKGKYGGAQATNDAAHSQISAADLEKAVQAQADKVRELKASTKDKAIWQPEVTKLLDLKK 864
            ..|:.|:.::||.|              ||:::        ||||....|               
Mouse   810 DQIENLRQRFGGGQ--------------LEESL--------ELKAKGSPK--------------- 837

  Fly   865 QLEEAKKKTATAAAPAATPAPSNGSQSVQDLEKAIQEQGDKVRKLKGSTKDKTVWQPEVNILLDL 929
                      .||..|.|.|   |||.:|.|...:.:||:.||:||....||.....||..||||
Mouse   838 ----------PAAVEAVTAA---GSQHIQTLTDEVTKQGNVVRELKAQKADKNQVAAEVAKLLDL 889

  Fly   930 KKQL 933
            ||||
Mouse   890 KKQL 893

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698 54/194 (28%)
GST_N_family 1..65 CDD:238319 19/71 (27%)
GST_C_family 63..164 CDD:295467 35/114 (31%)
PRK12268 254..812 CDD:237029 340/563 (60%)
MetRS_core 255..625 CDD:173907 249/372 (67%)
Anticodon_Ia_Met 634..763 CDD:153411 62/129 (48%)
MetRS_RNA 828..868 CDD:238475 7/40 (18%)
MetRS_RNA 895..938 CDD:238475 19/40 (48%)
MetRS_RNA 966..1009 CDD:238475
MarsNP_001165053.1 Thioredoxin_like 1..68 CDD:294274 18/70 (26%)
GstA <47..189 CDD:223698 47/153 (31%)
GST_C_MetRS_N 77..179 CDD:198340 33/113 (29%)
PRK12268 266..821 CDD:237029 339/562 (60%)
MetRS_core 267..635 CDD:173907 249/372 (67%)
'HIGH' region 275..285 10/10 (100%)
'KMSKS' region 595..599 4/4 (100%)
Anticodon_Ia_Met 644..773 CDD:153411 62/129 (48%)
MetRS_RNA 855..899 CDD:238475 19/40 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333215122
eggNOG 1 0.900 E1_COG0143
Hieranoid 1 1.000
Homologene 1 1.000 H90878
Inparanoid 1 1.050 806 1.000 Inparanoid score I485
Isobase 1 0.950 0 Normalized mean entropy S822
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004323
OrthoInspector 1 1.000 T1082336
orthoMCL 1 0.900 OOG5_127626
Panther 1 1.100 LDO PTHR45765
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1449
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.