DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and Mars2

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_780648.1 Gene:Mars2 MGIID:2444136 Length:586 Species:Mus musculus

Alignment Length:599 Identity:147/600 (25%)
Similarity:231/600 (39%) Gaps:106/600 (18%)


  Fly   252 GERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSR---SAGYNTLLICGTDEYGTATENKAL 313
            ||.....|:.:.|||..||:|::...:| ||...|:.|   ....:|....||||:|...:..|.
Mouse    34 GEARAYFTTPIFYVNAAPHIGHLYSALL-ADALCRHRRLRVPGSASTRFSTGTDEHGLKIQQAAA 97

  Fly   314 AENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESV-EQL 377
            ...|.|.|:||:.......::|...|....|.|||.......||. |..||:|..::.:.: |..
Mouse    98 TAGLAPIELCDRVSAQFLQLFREADISSTDFIRTTEARHRVAVQH-FWGVLEARGLLYKGIYEGW 161

  Fly   378 LCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVC-----NSAPVLR 437
            .|...:.||.:                            ...|..:.|....|     :..||..
Mouse   162 YCASDECFLPE----------------------------AKVTRQVGPSGDPCPVSLESGHPVSW 198

  Fly   438 SSDQLFI-DLPKAEPQLKEWVDKSEGGWT----HNAKVITRAWLKEGLKPRCITR---DLKWGIP 494
            :.::.:| .|.:....|:.|:..:....|    |.|.:   .||:|.|....::|   .|.||||
Mouse   199 TKEENYIFKLSQFREPLQRWLGNNPQAITPEPFHQAVL---QWLEEELPDLSVSRRSSHLHWGIP 260

  Fly   495 VPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSV 559
            ||  |.:.:..|||.||...|:::......:::.|| ||..      ..:.||.:.||::.||::
Mouse   261 VP--GDDSQTIYVWLDALVNYLTVVGYPDADFKSWW-PATS------HIIGKDILKFHAIYWPAL 316

  Fly   560 LL--AINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQD 622
            ||  .:...|.:..|    .:......|.|||.|..|......:. ...|.:|::|........|
Mouse   317 LLGAGLRPPHRIYVH----SHWTVSGQKMSKSLGNVVDPRTCLDR-YTVDGFRYFLLRQGVPNWD 376

  Fly   623 SSFSWNDLAARNNSELLNNLGNFVNRALV-----------FCEKNFSS----TVPGVITTQDELV 672
            ..:....:....:|||.:.||..:||...           ||...|.|    |.|.|....::..
Mouse   377 CDYYDEKVVKLLDSELADALGGLLNRCTAYRINPSGTYPSFCAACFPSEPGLTGPSVRVQAEDYA 441

  Fly   673 L---LALINRELRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTII 734
            |   :|.:.:.:.||.|..:..|..:.|...:   |..||::|...||.|...:.:......|::
Mouse   442 LVTAVATLPKLVAGYYNDFQIYKALEAVSSCV---RQTNGFVQRHAPWKLNWESPEDAPWLGTVL 503

  Fly   735 GLCVNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTL-LLPAGHQIGKPAP------ 792
            .:.:....:...||.|..|..|..|..:|....|    |:.|..| .||..:  |.|.|      
Mouse   504 HVALECLRVFGTLLQPVTPNLADKLLSRLGVSTT----ERGLGELYFLPRFY--GHPCPFEGRKL 562

  Fly   793 ------LFAKLEQS 800
                  ||.:|:||
Mouse   563 GPDTGLLFPRLDQS 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 145/598 (24%)
MetRS_core 255..625 CDD:173907 95/389 (24%)
Anticodon_Ia_Met 634..763 CDD:153411 35/147 (24%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
Mars2NP_780648.1 MetRS_core 37..379 CDD:173907 95/389 (24%)
PRK11893 39..574 CDD:237012 143/591 (24%)
'HIGH' region 45..55 6/10 (60%)
'KMSKS' region 340..344 3/4 (75%)
Anticodon_Ia_Met 388..532 CDD:153411 35/147 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.