DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and mars-1

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001255570.1 Gene:mars-1 WormBaseID:WBGene00003415 Length:917 Species:Caenorhabditis elegans

Alignment Length:795 Identity:353/796 (44%)
Similarity:485/796 (61%) Gaps:66/796 (8%)


  Fly   225 EISAAKAAFTYTAP--KEIKEERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARY 287
            :::..|.:|..:.|  .|.|:.:::||:||:||:|||:||||||||||||||||||||||::|||
 Worm     4 DLADIKKSFEASLPGYVEKKDPKSILPQPGKRNILITAALPYVNNVPHLGNIIGCVLSADVFARY 68

  Fly   288 SRSAGYNTLLICGTDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQ 352
            ....|:.|..:.||||||||||.|||.|..||||:||||..:|..||.||||.|.:||||||..|
 Worm    69 CNLRGHQTFYVGGTDEYGTATETKALQEGCTPRELCDKYHAIHKGIYEWFGIDFSHFGRTTTDHQ 133

  Fly   353 TDIVQEAFKDVLKAGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLV 417
            |:|.|:.|..:.|.||..::||:||.|.:|::|||||||.||||.  |.|:||||||||.||||:
 Worm   134 TEICQDMFLKLHKNGYTSSQSVDQLYCNQCEKFLADRFVTGTCPM--CAYDDARGDQCDGCGKLI 196

  Fly   418 NATELIRPRCKVCNSAPVLRSSDQLFIDLPKAEPQLKEWVD----KSEGGWTHNAKVITRAWLKE 478
            ||.:|...:|.:|.:.|.::.|..:|:.|.|.:.:..|.:|    |.:..|:.||..||:||:|.
 Worm   197 NAVDLKDAKCHMCKATPEVKQSTHIFLSLDKLQQKTTEHLDRELAKEDNRWSSNAVGITKAWMKL 261

  Fly   479 GLKPRCITRDLKWGIPVPHEGFEKKVFYVWFDAPFGYVSMTK-----RYTKEYQQWWQPAKGTDV 538
            ||.|||||||||||..||.:||||||||||||||.||:|:||     .:||    ||:..:  :|
 Worm   262 GLDPRCITRDLKWGTAVPLDGFEKKVFYVWFDAPIGYLSITKCVLGDNWTK----WWKNPE--NV 320

  Fly   539 ELFQFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETG 603
            |||.|:.||||.||:|::|...|..|..:|:|:::.|||||||||.|||||||.|:||:.||.|.
 Worm   321 ELFNFVGKDNVAFHAVMFPCSQLGANDNYTVVNNLCATEYLNYEDTKFSKSRGTGIFGDAAQGTE 385

  Fly   604 IPADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFSSTVPGVITTQ 668
            ||||:|||||...|||.||::|||:|...:.|||||||||||:||||.|...:|...||.:..|.
 Worm   386 IPADIWRFYLLYMRPESQDTAFSWDDFVLKVNSELLNNLGNFINRALSFVANSFGGVVPEMNLTN 450

  Fly   669 DELVLLALINRELRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTI 733
            |:..:|:.|:.|...:....:...|:|.|:.:|.:||.||.|||:|.||||:|..::.|.||.||
 Worm   451 DDAEVLSEIHNECMQWDKQFDGVHLKDAVKTILNVSRLGNQYMQAQTPWVLMKKDEEGKKRAGTI 515

  Fly   734 IGLCVNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTLLLPAGHQIGKPAPLFAKLE 798
            ||:..|||..::.||:|.|||.:.|:..|......||....|:  ..|.|||:||:|:|||.||:
 Worm   516 IGVAANIAYHVSVLLYPIMPTISATIREQCGLPALPLFTPFPI--CYLKAGHKIGQPSPLFQKLD 578

  Fly   799 QSFIDELKGKYGGAQATNDAAHSQISAADLEKAVQAQADKVRELK--ASTKDKAIWQPEVTKLLD 861
            .:.|.|.|.|:||:|             |.:.:....|:|.::.|  |.||||            
 Worm   579 PAQIAEFKAKFGGSQ-------------DAQSSAPKTAEKPKQQKKQAPTKDK------------ 618

  Fly   862 LKKQLEEAKKKTATAAAPAATPAPSNGSQSV-QDLEKAIQEQG----DKVRKLKGSTKDKTVWQP 921
                 :..||..:|||...........||.: |:|:|..|.:.    :::::|.|..|..|:   
 Worm   619 -----KGDKKMASTAAFVELEQGAKVISQLIAQNLKKFDQAKALFTRNQLQRLDGENKQLTI--- 675

  Fly   922 EVNILLDLKKQLE---AVQKAAKAAPAANAAPAASPAA--TADAAKVKALEDKIAQQAEKVRTLK 981
            :|..|.....:||   .:::..|...:....|.::||:  ..:|.|.:|.......:.:|.:..|
 Worm   676 DVKTLQHQLIELETAAGIKQVPKPVVSCTPTPTSTPASGIITEAPKKEAPSTPAPSEPKKAKEQK 740

  Fly   982 ATGDAAVWKPEVDIL 996
            .....|...|..|.:
 Worm   741 KGKGGAAAAPVDDTI 755

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 303/567 (53%)
MetRS_core 255..625 CDD:173907 218/379 (58%)
Anticodon_Ia_Met 634..763 CDD:153411 59/129 (46%)
MetRS_RNA 828..868 CDD:238475 8/42 (19%)
MetRS_RNA 895..938 CDD:238475 11/50 (22%)
MetRS_RNA 966..1009 CDD:238475 5/32 (16%)
mars-1NP_001255570.1 PLN02610 21..898 CDD:215329 350/779 (45%)
MetRS_core 36..407 CDD:173907 218/379 (58%)
Anticodon_Ia_Met 416..544 CDD:153411 58/128 (45%)
tRNA_bind_EMAP-II_like 755..857 CDD:239198 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333222774
eggNOG 1 0.900 E1_COG0143
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 641 1.000 Inparanoid score I440
Isobase 1 0.950 0 Normalized mean entropy S822
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D279987at33208
OrthoFinder 1 1.000 FOG0004323
OrthoInspector 1 1.000 T476987
orthoMCL 1 0.900 OOG5_127626
Panther 1 1.100 LDO PTHR45765
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1449
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.