DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS and Aimp1

DIOPT Version :9

Sequence 1:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_031952.2 Gene:Aimp1 / 13722 MGIID:102774 Length:319 Species:Mus musculus


Alignment Length:277 Identity:59/277 - (21%)
Similarity:102/277 - (36%) Gaps:99/277 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   808 KYGGAQATNDAAHSQISAADLEKAVQAQADKVRE-LK---ASTKDKAIWQP---EVTKL----LD 861
            ::.|..|||||...::.    :|.  |:||::.| ||   |..|:|||.|.   |..||    ..
Mouse     5 RFWGKMATNDAVLKRLE----QKG--AEADQIIEYLKQQVALLKEKAILQATMREEKKLRVENAK 63

  Fly   862 LKKQLEEAKKK-------------------------TAT-----AAAPAATPAPSNGSQSVQDLE 896
            |||::||.|::                         ||:     :.:.|.|.:|:...|.....|
Mouse    64 LKKEIEELKQELILAEIHNGVEQVRVRLSTPLQTNCTASESVVQSPSVATTASPATKEQIKAGEE 128

  Fly   897 KAIQEQGDKVRKLKGSTKDK-------TVWQP--------EVNILLDLKKQLEAVQKAAKAAPAA 946
            |.::|:.:|    ||..|:|       |..:|        .:..::..||..:|.....:.....
Mouse   129 KKVKEKTEK----KGEKKEKQQSAAASTDSKPIDASRLDLRIGCIVTAKKHPDADSLYVEEVDVG 189

  Fly   947 NAAPAASPAATADAAKVKALEDKI-----------------------AQQAEKVRTL-------- 980
            .|||....:...:...::.:::::                       |...|||..|        
Mouse   190 EAAPRTVVSGLVNHVPLEQMQNRMVVLLCNLKPAKMRGVLSQAMVMCASSPEKVEILAPPNGSVP 254

  Fly   981 --KATGDAAVWKPEVDI 995
              :.|.||...:|:.::
Mouse   255 GDRITFDAFPGEPDKEL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 0/3 (0%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411
MetRS_RNA 828..868 CDD:238475 19/50 (38%)
MetRS_RNA 895..938 CDD:238475 13/57 (23%)
MetRS_RNA 966..1009 CDD:238475 9/63 (14%)
Aimp1NP_031952.2 NUDE_C 17..>117 CDD:282704 26/105 (25%)
tRNA_bind_EMAP-II_like 157..259 CDD:239198 11/101 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.