DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and Yars

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_598912.5 Gene:Yars MGIID:2147627 Length:528 Species:Mus musculus

Alignment Length:353 Identity:72/354 (20%)
Similarity:127/354 (36%) Gaps:100/354 (28%)


  Fly   708 NGYMQSQQ-PWVLL----------------------------KGTDDQKTRASTIIGLCVNIACL 743
            :.|:.:.: ||.||                            ||||.|.::..|           
Mouse    77 HAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYT----------- 130

  Fly   744 LANLLFPYMPTTARTLFGQLNAK----QTPLNAEKPLVTLLLPAGHQIGKPAPLFAKLEQSFIDE 804
                |..|..::..|   |.:||    :.....|.||::.||..|.|         .|::.:: :
Mouse   131 ----LDVYRLSSVVT---QHDAKKAGAEVVKQVEHPLLSGLLYPGLQ---------ALDEEYL-K 178

  Fly   805 LKGKYGGAQATN--DAAHSQISAADLEKAVQAQADKVRELKASTKDKAIWQPEVTKLLDLKKQLE 867
            :..::||.....  ..|...:.|....|.|......|..|..|....:    |....:||..:.|
Mouse   179 VDAQFGGVDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSS----EEESKIDLLDRKE 239

  Fly   868 EAKKKTATAAAPAATPAPSNGSQS-VQDLEKAIQEQGDKVRKLK-GSTKDKTVW-------QPEV 923
            :.|||...|...... ..:||..| ::.:...::.:...:|..| |..|..||:       ..||
Mouse   240 DVKKKLKKAFCEPGN-VENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTVYLELEKDFAAEV 303

  Fly   924 NILLDLKKQLE-----------------AVQKAAKAA---PAANAAPAASPAATADAAKVKALED 968
            ....|||..:|                 |::|.|.||   |:....||..||..::..:|  :..
Mouse   304 VHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPPAKGPAKNSEPEEV--IPS 366

  Fly   969 KIAQQAEKVRTLKATGDA-AVWKPEVDI 995
            ::..:..|:.:::...|| :::..::|:
Mouse   367 RLDIRVGKILSVEKHPDADSLYVEKIDV 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 27/137 (20%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411 15/84 (18%)
MetRS_RNA 828..868 CDD:238475 9/40 (23%)
MetRS_RNA 895..938 CDD:238475 13/68 (19%)
MetRS_RNA 966..1009 CDD:238475 4/32 (13%)
YarsNP_598912.5 nt_trans 8..328 CDD:350862 57/284 (20%)
'HIGH' region 44..52
'KMSKS' region 222..226 0/4 (0%)
PLN02610 <327..528 CDD:215329 15/71 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.