DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MetRS and mars2

DIOPT Version :9

Sequence 1:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:XP_002940449.2 Gene:mars2 / 100488527 XenbaseID:XB-GENE-5862162 Length:571 Species:Xenopus tropicalis


Alignment Length:591 Identity:150/591 - (25%)
Similarity:224/591 - (37%) Gaps:107/591 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 GERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTDEYGTATENKALAEN 316
            |.|..|.|:.:.|||..||||::...:| ||:..|||...|..:.|..||||:|...:..|.|.:
 Frog    41 GTRPHLYTTPIFYVNASPHLGHVYSALL-ADVQHRYSAMCGIESRLSTGTDEHGMKVQQAASALS 104

  Fly   317 LTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESVEQLLCQK 381
            |.|...|.........|:....|.:..|.|||.....:.|...:..:.:.|||...:.|...|..
 Frog   105 LDPHTFCSSVSLQFRNIFDDLDISYTDFVRTTEPRHKEAVSRFWMTLEERGYIYKGTYEGWYCTS 169

  Fly   382 CDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNSAPVLRSSDQL---- 442
            .:.||:               |....::.|..|..:..:               |.|..|:    
 Frog   170 DEAFLS---------------EGQTAERIDSEGNKIRVS---------------LESGHQVHWVS 204

  Fly   443 ----FIDLPKAEPQLKEWVDKSEGGWTHNAKV--ITRAWLKEGLKPRCITRD---LKWGIPVPHE 498
                ...|....|.|..|:....   .|.|..  :...||:|.|....::|.   |.||||||.:
 Frog   205 EENYMFRLSSLRPALLNWLQTEP---VHPAPFLRLVHHWLEEELPDLSVSRQRSRLSWGIPVPSD 266

  Fly   499 GFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVLLA- 562
              ...|.|||.||...|::.......:...|     |....|   :.||.:.||::.||:.|:| 
 Frog   267 --SSHVIYVWLDALVNYLTAAGYPNLQLAPW-----GPSTHL---LGKDILRFHAIYWPAFLIAA 321

  Fly   563 -INKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFY---------LASAR 617
             ::..|.|:.|    .:...|..|.|||         .:....|||..|.|         |....
 Frog   322 GLSPPHKLLVH----SHWTSEGTKMSKS---------LKNVVDPADCIRRYTKDGLRYYLLRHGA 373

  Fly   618 PEGQDSSFSWNDLAARNNSELLNNLGNFVNRALV--------FCEKNFSSTVPGVITTQDELVLL 674
            || :|..|:........||||.:.||..:||...        |.:.::.| .|.....|.:.||.
 Frog   374 PE-RDCDFTHRTARTLLNSELADALGGLLNRCTAPAINPMQHFPKFHYDS-FPSAAHDQLQGVLA 436

  Fly   675 ALINRELRGYINS-MEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCV 738
            .|.|  |...::. ::|.::...:..:.|..|..|.:.|||.||.|.:|.:.:.....::|.:.:
 Frog   437 NLQN--LPAEVDQWVKKFQVHKALECIDACVRRSNAFFQSQAPWKLQRGVEKEAALRDSVIYVTL 499

  Fly   739 NIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTLLLPA---------GHQIG-KPAPL 793
            ....|.|.||.|.:|..|.....:|.   .||..........|.|         |..:| :...|
 Frog   500 ESLRLYATLLQPAVPGLATAALERLG---VPLEMRTLKGNTFLAATRGESCYFQGQTLGPEKGLL 561

  Fly   794 FAKLEQ 799
            |.:||:
 Frog   562 FPRLER 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 149/589 (25%)
MetRS_core 255..625 CDD:173907 100/393 (25%)
Anticodon_Ia_Met 634..763 CDD:153411 36/137 (26%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
mars2XP_002940449.2 PRK12267 48..>566 CDD:237028 145/581 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.