DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15097 and klhl7

Sequence 1:NP_001261079.1 Gene:CG15097 FlyBaseID:FBgn0034396 Length:743 Species:Drosophila melanogaster
Sequence 2:NP_957171.1 Gene:klhl7 ZFINID:ZDB-GENE-130212-1 Length:538 Species:Danio rerio

Alignment Length:553 Identity:160/554 (29%)
Similarity:257/554 (46%) Gaps:69/554 (12%)


  Fly    62 INQMRNNAQLCDVRLEVGGDTINAHRVVLASVSPYFYAMFNDDMLERTQGLVRLHDVDSSALRQL 126
            :|.:|....||||.|.|.|..|.||||||::.|.:|..||...|:|.:...|.|...:...:..|
Zfish    36 MNNLRKQGILCDVILVVEGKHILAHRVVLSAASHFFSLMFTSSMMEASNHEVELGGAEPEIIELL 100

  Fly   127 IDYTYTGEITITEQNVQVLLPASGLLQMHSVRDACCKFLLRQLHPSNCLGIRSFADAHSCKELHT 191
            :::.||..|::...|||.||.|:...|:..|:..|..||..|:..:|||||.:.|:..:|.||..
Zfish   101 VEFIYTARISVNSNNVQSLLNAANQYQIDPVKKMCVDFLKEQVDATNCLGISALAECLNCPELKV 165

  Fly   192 RSHKYALQNFQQVVGTEEFLLLPFEEVRELISNSQLNISSEERVFAAVINWVKHDLPTRRLHIAE 256
            .:..:..|:|..|...:|||.|..::|..|:....|.:.:|::::.|.:.|:|:|:..|:.:|.:
Zfish   166 AADDFIHQHFTNVYKMDEFLQLDVKQVTHLLQQDTLTVRAEDQIYDAAVRWLKYDVLNRQHYIVD 230

  Fly   257 LMSNVRLPLVSRDFLMSCVETETLMRDDSECKELLLEAMKYHLL-PEQRSIMGSQRTQERRPEGM 320
            ::..||.||||::||...|:.|.|::|:.||.::::..|:|||| ||.|..:|    :..||...
Zfish   231 ILGKVRFPLVSKNFLSKTVQAEPLIQDNPECLKMVICGMRYHLLSPEDREELG----ESSRPRRK 291

  Fly   321 K-PYVFAVGGGSLFAIHNECEVYNPRSNSWSPV-APMLWRRSRSGVTSLHKQLYVVGGYDGVSDL 383
            | .|..|:.|||.   ...|..:||:..|||.: .|...||..:.| .....:|::|| ..:..:
Zfish   292 KHDYRIALFGGSQ---PQSCRYFNPKDYSWSDIRCPFEKRRDAASV-FWDNVVYILGG-SQLFPI 351

  Fly   384 ATAESYNPLTNKWSNITPMGTKRSCLGICSYDALIYVCGGYD-GASCLSSMERYDPLTGIWSSCP 447
            ...:.||.:.:.|.:.......|..|..|:....||..||.: |:|.|:..|.|           
Zfish   352 KRMDCYNVVKDSWYSKLGPPNPRDSLAACASKGKIYTSGGSEVGSSALNLFECY----------- 405

  Fly   448 AMSTRRRYCRLAVLENCIYSLGGFDSTNYQSSVERFDPRVGRWQPVPSMSARRSSCGVASTDGHL 512
                                                |.|...||..|:|...|.|.|....:|.:
Zfish   406 ------------------------------------DTRTEAWQTKPNMLMPRCSHGSVEANGLI 434

  Fly   513 YCIGGNDGT----MCMSSGERFSLRRNSWEPIAAMHSRRSTHEVVEVEGALFALGGNDGSSSLNS 573
            |..||:.|.    ..::..|.:......|..:..|...|..|.:|.|...::|:||.:....|:|
Zfish   435 YVCGGSLGNNVSGRVLNDCEVYDPNTEEWRGLCGMREARKNHGLVVVNSRIYAVGGQNTLGGLDS 499

  Fly   574 VERYDTRLNKWSVVNAM-----VARRSSVGAAV 601
            ||.|:...|:|.:.:.|     ..|.::||:.:
Zfish   500 VEYYEIGSNEWKMASPMPWRGVTVRCAAVGSVI 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15097NP_001261079.1 BTB 63..166 CDD:279045 39/103 (38%)
PHA03098 65..539 CDD:222983 140/482 (29%)
BACK 174..276 CDD:285009 34/102 (33%)
Kelch 324..369 CDD:128874 14/46 (30%)
KELCH repeat 359..402 CDD:276965 8/43 (19%)
Kelch 370..415 CDD:128874 9/45 (20%)
KELCH repeat 406..450 CDD:276965 12/45 (27%)
Kelch 417..463 CDD:128874 9/47 (19%)
KELCH repeat 453..496 CDD:276965 5/43 (12%)
Kelch 464..510 CDD:128874 9/46 (20%)
Kelch_1 499..543 CDD:279660 10/48 (21%)
KELCH repeat 500..545 CDD:276965 11/49 (22%)
KELCH repeat 547..590 CDD:276965 14/43 (33%)
Kelch 559..603 CDD:128874 14/49 (29%)
klhl7NP_957171.1 BTB 36..140 CDD:279045 39/104 (38%)
PHA03098 41..538 CDD:222983 158/549 (29%)
BACK 148..250 CDD:285009 34/102 (33%)
KELCH repeat 328..370 CDD:276965 9/44 (20%)
KELCH repeat 374..418 CDD:276965 17/91 (19%)
Kelch 385..432 CDD:128874 18/94 (19%)
KELCH repeat 422..470 CDD:276965 11/48 (23%)
Kelch 433..482 CDD:128874 11/49 (22%)
Kelch_1 472..517 CDD:279660 15/45 (33%)
KELCH repeat 473..517 CDD:276965 15/44 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D312716at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.