DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15096 and C06E7.88

DIOPT Version :10

Sequence 1:NP_611376.1 Gene:CG15096 / 37170 FlyBaseID:FBgn0034394 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001255275.2 Gene:C06E7.88 / 13194964 WormBaseID:WBGene00189995 Length:167 Species:Caenorhabditis elegans


Alignment Length:33 Identity:9/33 - (27%)
Similarity:18/33 - (54%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 ITNGVANIMSIIAPLIVGFIVTNEHDPEQWRIV 446
            :|..|..::..:..|.|.|.:.::|  .|||::
 Worm     1 MTRSVIILVICLVGLPVAFGLESKH--WQWRLI 31

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15096NP_611376.1 MFS_SLC17 41..465 CDD:340876 9/33 (27%)
C06E7.88NP_001255275.2 None

Return to query results.
Submit another query.