DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15093 and GLYR1

Sequence 1:NP_001188972.1 Gene:CG15093 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_016879275.2 Gene:GLYR1 HGNCID:24434 Length:602 Species:Homo sapiens

Alignment Length:300 Identity:82/300 (27%)
Similarity:130/300 (43%) Gaps:34/300 (11%)


  Fly    29 KNIGFVGLGNMGANMASNLIKAGHKLHVFDISKPACDGLAAKGATVYAKTSELAKNSDFVITMLP 93
            |.|||:|||.||:.:.|||:|.||.:.|::.:...||....:||.:....:|:....|.....:.
Human   318 KKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVS 382

  Fly    94 N-NAIVDASYDEMTADGVNKDTIFIDSSTISPDLVKSLQKKISAKGARFIDAPVSGGVPGAEQAT 157
            : .|..|.........|:.....::|.||:..|.|..|.:.|.::|.||::|||||....:....
Human   383 DPKAAKDVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGM 447

  Fly   158 LTFMVGGTEAEYNAVKAVLECMGKKITHCGVYGMGQAAKLCNNMMLAISMI------GVSEAMNL 216
            |..:..|....|....:..:.|||.....|  .:|.|||    |||.::|:      .::|.:.|
Human   448 LVILAAGDRGLYEDCSSCFQAMGKTSFFLG--EVGNAAK----MMLIVNMVQGSFMATIAEGLTL 506

  Fly   217 AVRQGLDANVFAEIINSS-------TGRCWASEIYNPVPGVCPSAPANRDYAGGFSSALITKDLG 274
            |...|.......:|:|..       ..:|     .|.:.|         ::...|....|.|||.
Human   507 AQVTGQSQQTLLDILNQGQLASIFLDQKC-----QNILQG---------NFKPDFYLKYIQKDLR 557

  Fly   275 LASGVANASNSPIPLGSLAHKVYQSLCDKGLGNKDFSVVY 314
            ||..:.:|.|.|.|:.:.|::||:........:.|.|.||
Human   558 LAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVY 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 46/159 (29%)
HIBADH 33..318 CDD:130753 79/296 (27%)
NAD_binding_11 190..314 CDD:291499 34/137 (25%)
GLYR1XP_016879275.2 N_Pac_NP60 56..140 CDD:99897
DUF4603 137..>223 CDD:317743
NAD_bind_amino_acid_DH <260..>352 CDD:330244 16/34 (47%)
MmsB 318..600 CDD:224995 82/300 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126809
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.