DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15093 and rogdi

Sequence 1:NP_001188972.1 Gene:CG15093 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_956257.1 Gene:rogdi ZFINID:ZDB-GENE-030131-7582 Length:284 Species:Danio rerio

Alignment Length:94 Identity:24/95 (25%)
Similarity:42/95 (44%) Gaps:20/95 (21%)


  Fly   126 LVKSLQKKISAKGARFIDAPVSGGVPGAEQATLTFMVGGTEAEYNAVKAVLECMGKKITHCGVYG 190
            ::|.|| .|..:.:|.:..| |.|:.| :.....|::|.:..:  .||.||...|:.:|...:  
Zfish    27 VLKQLQ-DILKEASRRLSMP-SPGLEG-QLKQENFILGSSTMD--QVKGVLTLQGEALTQADI-- 84

  Fly   191 MGQAAKLCNNMMLAISMIGVSEAMNLAVR 219
                     |:.:|.|    |:.|:.|.|
Zfish    85 ---------NIKVAKS----SQVMHFAFR 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 17/61 (28%)
HIBADH 33..318 CDD:130753 24/95 (25%)
NAD_binding_11 190..314 CDD:291499 7/31 (23%)
rogdiNP_956257.1 Rogdi_lz 15..273 CDD:287261 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.