DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15093 and B0250.5

Sequence 1:NP_001188972.1 Gene:CG15093 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_507943.1 Gene:B0250.5 WormBaseID:WBGene00007122 Length:299 Species:Caenorhabditis elegans

Alignment Length:297 Identity:143/298 (48%)
Similarity:192/298 (64%) Gaps:12/298 (4%)


  Fly    32 GFVGLGNMGANMASNLIKAGHKLHVFDISKPACDGLAAKGATVYAKTSELAKNSDFVITMLPNNA 96
            ||:||||||.:||.||||.|.||.|:|::|.......|:|..|.|..:::|..|..:||:||::.
 Worm     5 GFIGLGNMGGHMARNLIKNGKKLIVYDVNKAVVQEFKAEGCEVAAHPADIAAASKEIITVLPSSP 69

  Fly    97 IVDASYDEMTADGVNK----DTIFIDSSTISPDLVKSLQKKISAK--GARFIDAPVSGGVPGAEQ 155
            .|.|.|....  |:.|    .|:.:|||||  |.:.||:...:|.  .|.:||||:||||.||:|
 Worm    70 HVKAVYQGEA--GIFKTIQPGTLCMDSSTI--DQIVSLEVAQAAALLKAEYIDAPISGGVTGAQQ 130

  Fly   156 ATLTFMVG-GTEAEYNAVKAVLECMGKKITHCGVYGMGQAAKLCNNMMLAISMIGVSEAMNLAVR 219
            |||||||| |.:|.:...:|||..|||.|.:.|..|.|.|||:||||:|.|.|:.|:|.|||.:.
 Worm   131 ATLTFMVGAGNDATFKRAEAVLSLMGKNIVNLGAVGNGTAAKICNNMLLGIQMVAVAETMNLGIS 195

  Fly   220 QGLDANVFAEIINSSTGRCWASEIYNPVPGVCPSAPANRDYAGGFSSALITKDLGLASGVANASN 284
            .||||...|.|:|:|:||||:|:.|||||||..:.|:.|.|||||.:.|:.|||.||...:..:.
 Worm   196 MGLDAKALAGIVNTSSGRCWSSDTYNPVPGVIENIPSCRGYAGGFGTTLMAKDLSLAQNASTNTQ 260

  Fly   285 SPIPLGSLAHKVYQSLC-DKGLGNKDFSVVYDLMKKE 320
            :|.|:|||||::|:.|. |.....|||.|||..:||:
 Worm   261 APTPMGSLAHQIYRILARDPQYQAKDFGVVYQFLKKQ 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 74/162 (46%)
HIBADH 33..318 CDD:130753 140/293 (48%)
NAD_binding_11 190..314 CDD:291499 65/125 (52%)
B0250.5NP_507943.1 NAD_binding_2 5..163 CDD:281445 74/162 (46%)
HIBADH 6..295 CDD:130753 140/293 (48%)
NAD_binding_11 166..279 CDD:291499 59/113 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134620126
eggNOG 1 0.900 E1_COG2084
Hieranoid 1 1.000
Homologene 1 1.000 H15088
Inparanoid 1 1.050 261 1.000 Inparanoid score I1896
Isobase 1 0.950 0 Normalized mean entropy S2299
OMA 1 1.010
OrthoDB 1 1.010 D524012at33208
OrthoFinder 1 1.000 FOG0005009
OrthoInspector 1 1.000 T474608
orthoMCL 1 0.900 OOG5_126809
Panther 1 1.100 LDO PTHR22981
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2375
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.