DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15093 and HIBADH

Sequence 1:NP_001188972.1 Gene:CG15093 FlyBaseID:FBgn0034390 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_689953.1 Gene:HIBADH HGNCID:4907 Length:336 Species:Homo sapiens

Alignment Length:331 Identity:155/332 (47%)
Similarity:211/332 (64%) Gaps:11/332 (3%)


  Fly     2 SLRVMSPAM-LNAWSQTL------VRAMSTQGGAKN--IGFVGLGNMGANMASNLIKAGHKLHVF 57
            |||::..|. |..||:.|      ..|:.::..|..  :||:||||||..||.||:|.|:.|.::
Human     4 SLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIY 68

  Fly    58 DISKPACDGLAAKGATVYAKTSELAKNSDFVITMLPN--NAIVDASYDEMTADGVNKDTIFIDSS 120
            |:...||......|..|.:..:::|:.:|.:|||||.  |||...|........|.|.::.||||
Human    69 DVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSS 133

  Fly   121 TISPDLVKSLQKKISAKGARFIDAPVSGGVPGAEQATLTFMVGGTEAEYNAVKAVLECMGKKITH 185
            ||.|.:.|.|.|::...||.|:||||||||..|....|||||||.|.|:.|.:.:|.|||..:.:
Human   134 TIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVY 198

  Fly   186 CGVYGMGQAAKLCNNMMLAISMIGVSEAMNLAVRQGLDANVFAEIINSSTGRCWASEIYNPVPGV 250
            ||..|.|||||:||||:|||||||.:|||||.:|.|||..:.|:|:|.|:||||:|:.|||||||
Human   199 CGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGV 263

  Fly   251 CPSAPANRDYAGGFSSALITKDLGLASGVANASNSPIPLGSLAHKVYQSLCDKGLGNKDFSVVYD 315
            ....|:..:|.|||.:.|:.||||||...|.::.|||.||||||::|:.:|.||...||||.|:.
Human   264 MDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQ 328

  Fly   316 LMKKEK 321
            .:::|:
Human   329 FLREEE 334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15093NP_001188972.1 NAD_binding_2 29..187 CDD:281445 70/162 (43%)
HIBADH 33..318 CDD:130753 143/287 (50%)
NAD_binding_11 190..314 CDD:291499 73/124 (59%)
HIBADHNP_689953.1 HIBADH 44..331 CDD:130753 143/287 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2084
Hieranoid 1 1.000
Homologene 1 1.000 H15088
Inparanoid 1 1.050 293 1.000 Inparanoid score I2734
Isobase 1 0.950 0 Normalized mean entropy S2299
OMA 1 1.010
OrthoDB 1 1.010 D524012at33208
OrthoFinder 1 1.000 FOG0005009
OrthoInspector 1 1.000 T1073662
orthoMCL 1 0.900 OOG5_126809
Panther 1 1.100 LDO PTHR22981
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2375
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.