DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and DIT2

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_010690.1 Gene:DIT2 SGDID:S000002810 Length:489 Species:Saccharomyces cerevisiae

Alignment Length:409 Identity:96/410 (23%)
Similarity:163/410 (40%) Gaps:82/410 (20%)


  Fly   153 SDQGQEWADIRNKVNPVLMKVQN--VRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKM 215
            |..|..|.:.||.|...|....:  :.:|...|..:.|..:  ||.|.:.....|:       :.
Yeast   121 SAYGAVWRNYRNAVTNGLQHFDDAPIFKNAKILCTLIKNRL--LEGQTSIPMGPLS-------QR 176

  Fly   216 WAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFN---YSFQF-DVQP---SIWTFYKTAGF 273
            .|.::||.|||....|.|:...:...:.|.:..:..|:   .:|.| ||.|   ....|.....|
Yeast   177 MALDNISQVALGFDFGALTHEKNAFHEHLIRIKKQIFHPFFLTFPFLDVLPIPSRKKAFKDVVSF 241

  Fly   274 KKFL--KTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKV-----AVTMVMDMLMA 331
            ::.|  :..|   ::.:||          ..:..|....:.:..||.::     ....::.:|:|
Yeast   242 RELLVKRVQD---ELVNNY----------KFEQTTFAASDLIRAHNNEIIDYKQLTDNIVIILVA 293

  Fly   332 GIDTTSSACLTILYHLARNPSK-QEKLRRELLRILPTTKDSLTD-QNTKNMPYLRACIKEGLRI- 393
            |.:.......:.||.||:..:: |||||:|:        :.:|| :...::|.|.|.:.|.:|: 
Yeast   294 GHENPQLLFNSSLYLLAKYSNEWQEKLRKEV--------NGITDPKGLADLPLLNAFLFEVVRMY 350

  Fly   394 ----TSITPGNFRITPKDLVLSG-YQVPRGTGVLMGVLELSNDDKYFAQSS-EFIPERWLKSDLA 452
                |.|.    |.|.|...|.. ..:|:|..|.......|:|.|.:..:: :|.||||     .
Yeast   351 PPLSTIIN----RCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERW-----G 406

  Fly   453 PDIQACPA--ARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYEST 515
            .||:....  ...:|......|..|.|.|:|:::|..|:...|..:|:.::.|..|    |:|. 
Yeast   407 SDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDP----EWEE- 466

  Fly   516 IILSPCGDIRFKLEPVGDL 534
                       ||.|.|.|
Yeast   467 -----------KLTPAGPL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 89/385 (23%)
DIT2NP_010690.1 CypX 23..483 CDD:225035 96/410 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.