DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and CYP705A1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_193268.3 Gene:CYP705A1 AraportID:AT4G15330 Length:513 Species:Arabidopsis thaliana

Alignment Length:478 Identity:98/479 (20%)
Similarity:187/479 (39%) Gaps:66/479 (14%)


  Fly    52 SFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGD-----IYCIPGMMGKPNAVFTYNP 111
            :|..:|.|..|.::...   ..|.:|.:.:..:.:...||.     |:.||.::...:::.....
plant    35 NFDLLPSPPSLPIIGHL---HLLLSTLIHKSLQKLSSKYGPLLHLRIFNIPFILVSSDSLAYEIF 96

  Fly   112 DDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKV-------NPV 169
            .|.::...:.||..|.   |||          .|...|.:.:..|..|..::..:       .| 
plant    97 RDHDVNVSSRGVGAID---ESL----------AFGSSGFIQAPYGDYWKFMKKLIATKLLGPQP- 147

  Fly   170 LMKVQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQ--LKMWAFESISFVALNTRMGL 232
            |::.|:.|..  :|::..|...||...:.:...|...:.|.|.  .||....|.|          
plant   148 LVRSQDFRSE--ELERFYKRLFDKAMKKESVMIHKEASRFVNNSLYKMCTGRSFS---------- 200

  Fly   233 LSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRG 297
            :.:|   ..:|:.:...|....|.:|.|........:..|...|......::...|..:|..:..
plant   201 VENN---EVERIMELTADLGALSQKFFVSKMFRKLLEKLGISLFKTEIMVVSRRFSELVERILIE 262

  Fly   298 FGKNDDGK-----TKCVLEQLLEHNKKVAVT------MVMDMLMAGIDTTSSACLTILYHLARNP 351
            :.:..||.     ...:|....:.|.:..:|      ::.:..:...|.:|.|....:..:..|.
plant   263 YEEKMDGHQGTQFMDALLAAYRDENTEYKITRSHIKSLLTEFFIGAADASSIAIQWAMADIINNR 327

  Fly   352 SKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVP 416
            ...||||.|:..::..|: .:.:.:..|:|||:|.:|||||:...||...|...:...:.|:.||
plant   328 EILEKLREEIDSVVGKTR-LVQETDLPNLPYLQAVVKEGLRLHPPTPLVVREFQEGCEIGGFFVP 391

  Fly   417 RGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIG 481
            :.|.:::....:..|...:....||.|||:|.| |:.:     ..:......:||||.|.|.|.|
plant   392 KNTTLIVNSYAMMRDPDSWQDPDEFKPERFLAS-LSRE-----EDKKEKILNFLPFGSGRRMCPG 450

  Fly   482 KRIAELEIETLLVRLLRSYKVSW 504
            ..:..:.:.|.:..:::.:  .|
plant   451 SNLGYIFVGTAIGMMVQCF--DW 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 96/472 (20%)
CYP705A1NP_193268.3 p450 15..501 CDD:325183 98/479 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.