DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and CYP71A12

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_180633.3 Gene:CYP71A12 AraportID:AT2G30750 Length:497 Species:Arabidopsis thaliana

Alignment Length:417 Identity:91/418 (22%)
Similarity:166/418 (40%) Gaps:88/418 (21%)


  Fly   146 KGVGGLAS--------DQGQEWADIRN------KVNPVLMKVQNVRQNLPQLDQISKEFIDKLET 196
            |.|.||.:        ..|:.|..:::      ..|.::...:.:|:.  :|:::.|: ::|..:
plant   104 KAVHGLMNGGRDVVFGPYGEYWRQMKSVCILNLLTNKMVASFEKIREE--ELNEMIKK-LEKASS 165

  Fly   197 QRNPET-----HTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSF 256
            ..:.|.     .||.:|.           .|.:||..:     .:.|..|..|.|.:|.......
plant   166 SSSSENLSELFVTLPSDV-----------TSRIALGRK-----HSEDETARDLKKRVRQIMELLG 214

  Fly   257 QF---DVQPSIWTFYKTAGFKKFLK-TYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHN 317
            :|   |..|::....:..||...:| .....:|:....::..:.. |.:.:.....:|.  :|..
plant   215 EFPIGDYVPALAWIDRINGFNARIKEVSQGFSDLMDKVVQEHLEA-GNHKEDFVDILLS--IESE 276

  Fly   318 KKVAVT--------MVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTD 374
            |.:...        |::||.:.|..|:|:....|:..|.|||:..:||:.|:...:......:.:
plant   277 KSIGFQAQRDDIKFMILDMFIGGTSTSSTLLEWIMTELIRNPNVMKKLQDEIRSTIRPHGSYIKE 341

  Fly   375 QNTKNMPYLRACIKEGLRI----TSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYF 435
            ::.:||.||:|.|||..|:    ..|.|   |:..:|:.:.||.:..||.|::....:..|...:
plant   342 KDVENMKYLKAVIKEVFRVHPPLPLILP---RLLSEDVKVKGYNIAAGTEVIINAWAIQRDPAIW 403

  Fly   436 A-QSSEFIPERWLKSDL---APDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRL 496
            . .:.||.|||.|.|.|   ..|:.            ::|||.|.|.|.|..:|...:|..:..|
plant   404 GPDAEEFKPERHLDSTLDYHGKDLN------------FIPFGSGRRICPGINLALGLVEVTVANL 456

  Fly   497 LRSYKVSWLPETPIEYESTIILSPCGD 523
            :..:  .|..|.          .|.||
plant   457 VGRF--DWRAEA----------GPNGD 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 88/404 (22%)
CYP71A12NP_180633.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.