DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and si:dkey-91i10.3

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001116749.1 Gene:si:dkey-91i10.3 ZFINID:ZDB-GENE-081105-124 Length:513 Species:Danio rerio

Alignment Length:469 Identity:133/470 (28%)
Similarity:232/470 (49%) Gaps:46/470 (10%)


  Fly    51 RSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFE 115
            ::..::.|||.|..|.:....|..:.|:.:|:..  .::||.::  ....|....|...:.|..|
Zfish    44 KTMDDLDGPSFLTSLYWLFGKGYFQTTHQMQIEH--SKIYGPLW--KSKYGPLVIVNVASADLIE 104

  Fly   116 MTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNVRQNL 180
            ...|.||..|||..:.....|||: |...:    |..::.|.||..||:.:||.::|.::|....
Zfish   105 QVLRQEGRHPIRTDMPHWRGYRKL-RNHAY----GPLTEMGPEWQRIRSILNPRMLKPKHVSNYT 164

  Fly   181 PQLDQISKEFID---KLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNAD 242
            ..::.:..:||:   ||:|.:..:  .:..|...:|..:|||.||.|...||||.|:|.......
Zfish   165 NAINGVVSDFIEKMAKLKTTKGND--VMVYDVAGELYKFAFEGISSVLFETRMGCLNDEIPEETQ 227

  Fly   243 RLAKHMRDFFNYSFQFDVQPSIWTFYK-----TAGFKKFLKTYDNITDITSNYIETAMRGFGKND 302
            :.      .|:....|.:.|.:..|.|     ...:|.|:..:|::..:....::..|...  .:
Zfish   228 KF------IFSVGEMFRLSPIVILFPKFLWPYMPFWKHFVAVWDHLFKVADELVQQKMTEI--QE 284

  Fly   303 DGKTKCVLE-QLLEH---NKKVAVTMVM----DMLMAGIDTTSSACLTILYHLARNPSKQEKLRR 359
            ..||...:| :.|.|   :::::.|.|:    ::|:||:||||:.....||||||.|..|:||..
Zfish   285 KVKTGSPVEGEYLTHLLISEQMSFTEVLGSITELLLAGVDTTSNTISWALYHLAREPEIQQKLHE 349

  Fly   360 ELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPK-DLVLSGYQVPRGTGVLM 423
            |::.:.|..|...:|..|: ||.|:|.::|.||:..:.|||.|:..: ::|:..:..|:.|...:
Zfish   350 EVVSVCPGDKTPSSDDITR-MPLLKAIVRETLRLYPVVPGNARVVAENEIVVGDHLFPKNTLFHL 413

  Fly   424 GVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELE 488
            ....:|.|:..|.....|:|:||::..         ...:::||..:|||||.|.|:|:|:||||
Zfish   414 CHFAVSYDETVFPDPFAFLPQRWIREQ---------KQLSQHPFGSVPFGFGIRACLGRRVAELE 469

  Fly   489 IETLLVRLLRSYKV 502
            :..||.||::.|:|
Zfish   470 MYLLLSRLIKRYEV 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 132/462 (29%)
si:dkey-91i10.3NP_001116749.1 p450 52..510 CDD:278495 132/462 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3480
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.