DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and cyp11a2

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_021329545.1 Gene:cyp11a2 ZFINID:ZDB-GENE-130911-1 Length:512 Species:Danio rerio

Alignment Length:521 Identity:145/522 (28%)
Similarity:247/522 (47%) Gaps:75/522 (14%)


  Fly    38 LADSRIDEKWQQARSFGEIPGP---SLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGM 99
            |.||.:       |.|.||||.   ||..:.:|...|| |||.:.|.::..  ..:|.||  ...
Zfish    36 LQDSTV-------RPFNEIPGQWRNSLKSVFAFAKMGG-LRNIHRIMVHNF--NTFGPIY--REK 88

  Fly   100 MGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWAD--- 161
            :|...:|....|:|..:.::.||.:|.|:.:::...||....    :..|.|..| |::|..   
Zfish    89 VGFYESVNIIKPEDAAILFKAEGHYPKRLTIDAWTAYRDYRN----RKYGVLLKD-GEDWKSNRI 148

  Fly   162 IRNK--VNPVLMKVQNVRQNLPQLDQISKEFIDKL--ETQRNPETHTLTTDFHNQLKMWAFESIS 222
            |.||  ::|   |||.  ..:|.||::.::|:.::  :.:|:.: :..|||..::|..:|.||:|
Zfish   149 ILNKEVISP---KVQG--NFVPLLDEVGQDFVARVNKKIERSGQ-NQWTTDLSHELFKFALESVS 207

  Fly   223 FVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQF---------DVQPSIWTFYKTAGFKKFLK 278
            .|....|:|||.|..||::.|....:...|..:...         .::..||        :..::
Zfish   208 AVLYGERLGLLLDYIDPDSQRFIDCITLMFKTTSPMLYLPPGLLRPIRSKIW--------RNHVE 264

  Fly   279 TYDNITDITSNYIETAMRGFGKNDDGKTKC--VLEQLLEHNK------KVAVTMVMDMLMAGIDT 335
            .:|.|.:.....|:...|...||.:|..|.  ||..||..:|      |.:||   :::..|:||
Zfish   265 AWDGIFNQADRCIQNIYRQLRKNPEGNGKYTGVLASLLMLDKLSIEDIKASVT---ELMAGGVDT 326

  Fly   336 TSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGN 400
            |:...|..||.|||||..||::|.|:......:|..:. |..|.:|.::..:||.||:..:....
Zfish   327 TAITLLWTLYELARNPDLQEEIRAEISAARIASKGDMV-QMLKMIPLVKGTLKETLRLHPVAVSL 390

  Fly   401 FRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRN 465
            .|...:|:|:..|.:|.||.|.:|:..:..|.:.|....:::|.||:.|.             .:
Zfish   391 QRYITEDIVIQKYHIPAGTLVQLGLYAMGRDHQVFPNPEQYLPSRWVNSQ-------------NH 442

  Fly   466 PFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYESTIILSPCGDIRFKLEP 530
            .|..|.||||||.|:|:||||.|::..|:.:|.::::....:..::....:||.|...|...::|
Zfish   443 YFKSLSFGFGPRQCLGRRIAETEMQLFLIHMLENFRIEKQRQMEVKSMFELILLPEKPIMLTIKP 507

  Fly   531 V 531
            :
Zfish   508 L 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 131/479 (27%)
cyp11a2XP_021329545.1 p450 69..505 CDD:306555 128/476 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.