DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and cyp27c1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001106808.2 Gene:cyp27c1 ZFINID:ZDB-GENE-080204-68 Length:540 Species:Danio rerio

Alignment Length:552 Identity:139/553 (25%)
Similarity:261/553 (47%) Gaps:79/553 (14%)


  Fly     9 IYRNVSGNQLWFNRNSSVGGTLSQQTQLELADSRIDEKWQQARSFGEIPGPS-LLRMLSFFMPGG 72
            ::::|:...|....:|.  ..|.:::.:..|:.  .:|..:.:|..|:|||| :..:|.||...|
Zfish    30 LHKSVASGSLEIAAHSQ--ADLKEESAVSPAEE--VQKAARVKSLKEMPGPSTVANLLEFFYRDG 90

  Fly    73 ALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYR 137
            ..| .:.|||....:  ||.|:  ....|....|...:.|......|:|...|.|..:||...||
Zfish    91 FSR-IHEIQMEHAKK--YGKIF--KSRFGPQFVVSIADRDMVAQVLRSESATPQRGNMESWKEYR 150

  Fly   138 KIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPET 202
            .:.....     ||.|.:|.||..:|:.:..::|:.::|......::.:..:.:.:::|.|:.:.
Zfish   151 DLRGRST-----GLISAEGDEWLKMRSVLRQLIMRPRDVAVFSSDVNDVVADLVKRVKTLRSQQD 210

  Fly   203 HTLTT-DFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADR---LAKHMRDFFNYSFQFDVQPS 263
            .:.|. :.::....:|.|.::.:...||:|.| :|..|...:   .|.|:               
Zfish   211 DSQTVLNINDLFFKYAMEGVATILYETRLGCL-ENEIPKMSQEYITALHL--------------- 259

  Fly   264 IWTFYKT---AG-------------FKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQ 312
            :::.:||   ||             :::|..::|.:...:..:::..:....|..: |::.:...
Zfish   260 MFSSFKTTMYAGAIPKWLRPIIPKPWEEFCSSWDGLFKFSQIHVDKRLSEIKKQME-KSEEIKGG 323

  Fly   313 LLEH-------NKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELLRIL----P 366
            ||.|       |.:.....:.:||:||:||||.......|.|||:|:.|:::..|:.|:|    |
Zfish   324 LLTHMLVTREMNLEEIYANMTEMLLAGVDTTSFTLSWSTYLLARHPTIQQQIFEEVDRVLGGRVP 388

  Fly   367 TTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSND 431
            |.:|      ...:|.:|..:||.||:..:.|||.|:|..||::.||.:|:||.:.:.....|.|
Zfish   389 TGED------VPYLPLIRGLVKETLRLFPVLPGNGRVTHDDLIVGGYLIPKGTQLALCHYSTSMD 447

  Fly   432 DKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRL 496
            ::.|.:..||.|:||::.|.:..:         :.|..:|||:|.|:|||:||||||:...|.:|
Zfish   448 EENFPRPEEFRPDRWIRKDASDRV---------DNFGSIPFGYGIRSCIGRRIAELEMHLALTQL 503

  Fly   497 LRSYKVSWLPETPIEYESTI-ILSPCGDIRFK 527
            |:::.:...|:|...:..|. :|.|...|..:
Zfish   504 LQNFHIEVSPQTTEVHAKTHGLLCPGASINLR 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 125/484 (26%)
cyp27c1NP_001106808.2 p450 74..517 CDD:306555 127/485 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3480
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.