DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and si:ch211-113j14.1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_686522.4 Gene:si:ch211-113j14.1 ZFINID:ZDB-GENE-120215-110 Length:573 Species:Danio rerio

Alignment Length:522 Identity:148/523 (28%)
Similarity:258/523 (49%) Gaps:45/523 (9%)


  Fly    26 VGGTLSQQT---QLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMR 87
            :..||..||   .|:.|:: |..::   ::..::|||:|...:.:....|....::.:|:..  :
Zfish    78 IARTLKSQTGDVDLQSANT-ITGRY---KTKDDLPGPNLATTVYWLFVKGYADKSHAMQVEH--K 136

  Fly    88 EMYGDIYCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLA 152
            .:||.|:  ....|..:.:.....|......|.||.:|:|..|.....||     |:.....|:.
Zfish   137 RLYGPIW--RSRFGPFDVINVAGADLIAQVIRQEGRYPVRTDLPHWREYR-----DMRGQAYGIH 194

  Fly   153 SDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLE--TQRNPETHTLTTDFHNQLKM 215
            .|.|.||..||:.:||.::|::.|....|.:.::..:.:.:||  ..|:|:..|: :|..::|..
Zfish   195 VDTGPEWYRIRSALNPKMLKLKEVTAYAPIIHEVVSDLLQRLELLRLRSPDQITV-SDLASELYK 258

  Fly   216 WAFESISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTY 280
            :.||.||.:...||:|.|.:....:..|....:.:....|......|. ||.:....:|:|::.:
Zfish   259 FGFEGISSILFETRLGCLQEEIPTDTLRFISAVNEMLALSETVLFFPR-WTRHIFPFWKRFVQAW 322

  Fly   281 DNITDITSNYIETAMRGF------GKNDDGKTKCVLEQLLEHNK----KVAVTMVMDMLMAGIDT 335
            |.:.|:..:.|:..:...      |:..:|   ..|..||..||    :|.:::. ::|:.|:||
Zfish   323 DELYDVARHLIDKKVNEIRDQVARGEEVEG---MYLTYLLSSNKLSLGEVYISLT-ELLLGGVDT 383

  Fly   336 TSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGN 400
            ||:.....||||||||..|::|..|::.:.|..|...||..|| |||::|.|||.||:..:.|||
Zfish   384 TSNTLSWTLYHLARNPEIQKRLHNEIVSVCPNKKVPNTDDLTK-MPYMKAVIKEILRMYPVVPGN 447

  Fly   401 FRIT-PKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTR 464
            .|:| ..|:|:..|..|:.|...:....:|:|:..|..:..|:||||::..        |:....
Zfish   448 GRLTVDSDIVVDNYWFPKKTQFHLCHYAVSHDENNFPDAERFVPERWIRDS--------PSRSQH 504

  Fly   465 NPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETP-IEYESTIILSPCGDIRFKL 528
            :|:..:|||.|.|.|:|||:||||:...|.||::.|:|.....:| |:.::..:|.|...|..:.
Zfish   505 HPYSSVPFGVGVRACVGKRVAELEMYFALSRLMQQYEVRTKAGSPSIQPKTRTLLIPSQPIDLQF 569

  Fly   529 EP 530
            .|
Zfish   570 IP 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 135/466 (29%)
si:ch211-113j14.1XP_686522.4 p450 108..569 CDD:278495 140/485 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3480
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.