DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and cyp27c1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001011341.1 Gene:cyp27c1 XenbaseID:XB-GENE-6257635 Length:469 Species:Xenopus tropicalis

Alignment Length:502 Identity:133/503 (26%)
Similarity:244/503 (49%) Gaps:68/503 (14%)


  Fly    56 IPGPS-LLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFEMTYR 119
            :|||| :..::.||...|..|...:.|.:   ...||.|:  ....|....|...:.|......|
 Frog     1 MPGPSTMANLVEFFWRDGFGRIQEIQQKH---ARQYGRIF--KSHFGPQFVVSIADKDMVAQVLR 60

  Fly   120 NEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLD 184
            .|...|.|..:||.:.||::.....     ||.|.:|::|.::|:.:...:::.::|......::
 Frog    61 AERDAPQRANMESWHEYRELRGRST-----GLISAEGEKWLNMRSVLRQKILRPRDVAMYSGGVN 120

  Fly   185 QISKEFIDKLETQRNPETHTLTTDFHNQLKM-WAFESISFVALNTRMGLLSDNPDPNADRLAKHM 248
            ::.::.:.::...|..|:..||....|.|.. ::.|:|:.:....|:|.|.       |::.:..
 Frog   121 EVVEDLVKRIRKLRVQESDGLTVTNVNDLYFKYSMEAIATILYECRLGCLD-------DQIPQQT 178

  Fly   249 RDFFNYSFQFDVQPSIWTFYKT---AG-------------FKKFLKTYDNITDITSNYIETAMRG 297
            :::      .:....:::.:||   ||             :::|.:::|.:...:..:::..:|.
 Frog   179 KEY------IEALELMFSMFKTTMYAGAIPKWLRPLIPKPWREFCRSWDGLFKFSQIHVDDRLRQ 237

  Fly   298 F------GKNDDGKTKCVLEQLL---EHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSK 353
            .      |:...|.   ||..||   |.:.:.....:.:||:||:||||.......|.||:||..
 Frog   238 IESQLEKGEEVQGG---VLTHLLLSKELDLEEIYANMTEMLLAGVDTTSFTLSWATYLLAKNPGI 299

  Fly   354 QEKLRRELLRILPTTKDSL-TDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPR 417
            ||.:.:::::..  .||.: |.::...||.:||.:||.||:..:.|||.|:|..|||:.||.:|:
 Frog   300 QEAVYQQIVQNF--GKDQVPTAEDVPKMPLVRAVVKETLRLFPVLPGNGRVTQDDLVVGGYFIPK 362

  Fly   418 GTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGK 482
            ||.:.:.....|.|.:.|..:.||.||||::|.        ...|..| |..:|||:|.|:|||:
 Frog   363 GTQLALCHYSTSYDAECFPAAEEFRPERWIRSG--------NLERKEN-FGSIPFGYGIRSCIGR 418

  Fly   483 RIAELEIETLLVRLLRSYKVSWLPETPIEYESTI-ILSPCG--DIRF 526
            |:||||:..||::||:::::...|:|......|. :|.|.|  ::||
 Frog   419 RVAELEMHLLLIQLLQNFEIKPSPQTTTVLPKTHGLLCPGGKINVRF 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 125/480 (26%)
cyp27c1NP_001011341.1 p450 2..457 CDD:306555 129/492 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.