DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and cyp27a7

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_002663445.1 Gene:cyp27a7 ZFINID:ZDB-GENE-081104-519 Length:524 Species:Danio rerio

Alignment Length:476 Identity:131/477 (27%)
Similarity:226/477 (47%) Gaps:37/477 (8%)


  Fly    39 ADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKP 103
            |...:.:..::.::..::|...:..||...:..|.|...:.:|:..  :::||.:|.|  .:|..
Zfish    39 ASVSVQDGHRKLKTEADLPEIKIFTMLYRLLFKGYLSRMHELQLYE--KQLYGPLYKI--NVGNF 99

  Fly   104 NAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVG-GLASDQGQEWADIRNKVN 167
            .:|...:.|..|...|.:..:|.|..:.....||.:      ||:| |..:::|::|..:|..:|
Zfish   100 QSVALNSVDLLEELLRKDEKFPSRGDMTLWTEYRDM------KGIGYGPFTEEGEKWYKLRAVLN 158

  Fly   168 PVLMKVQNVRQNLPQLDQISKEFIDKLETQRN-PETHTLTTDFHNQLKMWAFESISFVALNTRMG 231
            ..::..::..|....::.:..:||.::...|. ..|..|.::..|:|..::.|.||.:...||:|
Zfish   159 KRMLHPKDSVQYGDVVNAVITDFIKRIYYLREMSPTGDLVSNLTNELYRFSLEGISSILFETRIG 223

  Fly   232 LLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMR 296
            .|..............:.....||......|: ||......:::::..:|.|.......|:..|.
Zfish   224 CLEKEIPAETQHFINSIAQMLTYSMPVVFMPN-WTRNYLPFWQRYIGGWDGIFKFAGKMIDMKME 287

  Fly   297 GFGKNDDGKTKCV---LEQLLEHNK---KVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQE 355
            ...|..|...:..   |..||.:.|   |.....|.::|:||:||||:..|..||||:::|..|:
Zfish   288 ALQKRVDANQEVAGEYLTYLLSNGKMSSKDVYGSVSELLLAGVDTTSNTMLFALYHLSKDPETQD 352

  Fly   356 KLRRELLRILPTTKDSL--TDQNTKNMPYLRACIKEGLRITSITPGNFR-ITPKDLVLSGYQVPR 417
            .|.:|:..:|   ||..  |.|....|.||:|.|||.||:..:.|.|.| |...::|:.|:..|:
Zfish   353 ILYQEVTNVL---KDDRIPTAQEVNTMSYLKAVIKETLRLYPVVPMNARLIAENEVVIGGHLFPK 414

  Fly   418 GTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTR-NPFVYLPFGFGPRTCIG 481
            .|...:....:|.|:|.|.:..:|.|||||:.           .||| |||..:|||||.|.|:|
Zfish   415 NTTFTLCHYAISRDEKVFPEPQKFKPERWLRD-----------GRTRPNPFGSIPFGFGVRGCVG 468

  Fly   482 KRIAELEIETLLVRLLRSYKV 502
            :||||||:...|.||::.:::
Zfish   469 RRIAELEMYLALARLIKLFEI 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 129/457 (28%)
cyp27a7XP_002663445.1 p450 68..507 CDD:278495 127/448 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I3480
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128678
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.