DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and Cyp12d1-p

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001286304.1 Gene:Cyp12d1-p FlyBaseID:FBgn0050489 Length:521 Species:Drosophila melanogaster

Alignment Length:524 Identity:191/525 (36%)
Similarity:303/525 (58%) Gaps:36/525 (7%)


  Fly    22 RNSSVGGTLSQQTQLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLM 86
            |:|.....|:.    |.|.|.|.|   :.:::.|||.|:..:.:..|||||..:|.::.:....|
  Fly    18 RSSRSASVLAH----EQAKSSITE---EHKTYDEIPRPNKFKFMRAFMPGGEFQNASITEYTSAM 75

  Fly    87 REMYGDIYCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGL 151
            |:.|||||.:|||.|:.:.|.|:|..|.||.:||||:||.|.||:|:.|:|:..||||:..|.||
  Fly    76 RKRYGDIYVMPGMFGRKDWVTTFNTKDIEMVFRNEGIWPRRDGLDSIVYFREHVRPDVYGEVQGL 140

  Fly   152 ASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKMW 216
            .:.|.:.|..:|:.:||:.|:.:.:|.....|..|:.|||::::..|:|:|..:..||.:::...
  Fly   141 VASQNEAWGKLRSAINPIFMQPRGLRMYYEPLSNINNEFIERIKEIRDPKTLEVPEDFTDEISRL 205

  Fly   217 AFESISFVALNTRMGLLSDNPDPNADRLA--KHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKT 279
            .|||:..||.:.:|||:..|.| |:|.|.  :..||.|..:|:.|:|||:|....|..::|..:|
  Fly   206 VFESLGLVAFDRQMGLIRKNRD-NSDALTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKMKRT 269

  Fly   280 YDNITDITSNYIETAMRGFGKNDDGKTK-----------CVLEQLLEHNKKVAVTMVMDMLMAGI 333
            .::..::....::       :|.|...|           .:||:|:|.:.||||.|.:|:|.||:
  Fly   270 LNDSLNVAQKMLK-------ENQDALEKRRQAGEKINSNSMLERLMEIDPKVAVIMSLDILFAGV 327

  Fly   334 DTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITP 398
            |.|::....:|..|:::|.||.|||.|||.|:||....|.::|.|:||||||.|||.||......
  Fly   328 DATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLRYYPNGL 392

  Fly   399 GNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKS-DLAPDIQACPAAR 462
            |..|....|::||||:||:||.||:|...|..:..|:.:..||:|||||:. :....:|.     
  Fly   393 GTMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQV----- 452

  Fly   463 TRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIEYESTIILSPCGDIRFK 527
              :||.:||||||||.|||||:.:||:||.:.:|:|::.|.:..:....:::..::.|.....||
  Fly   453 --SPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVEFNRDASRPFKTMFVMEPAITFPFK 515

  Fly   528 LEPV 531
            ...:
  Fly   516 FTDI 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 177/466 (38%)
Cyp12d1-pNP_001286304.1 p450 70..508 CDD:299894 170/453 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130816511
eggNOG 1 0.900 E2759_KOG0159
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I2276
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0001319
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24305
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.