DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and CYP24A1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_000773.2 Gene:CYP24A1 HGNCID:2602 Length:514 Species:Homo sapiens

Alignment Length:487 Identity:129/488 (26%)
Similarity:228/488 (47%) Gaps:49/488 (10%)


  Fly    49 QARSFGEIPGPS----LLRMLSFFMPGGALR-NTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFT 108
            :.::...:|||:    |..:|.....||..: :..|::.::    .||.|:.:  .:|...:|..
Human    51 ETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHK----KYGKIFRM--KLGSFESVHL 109

  Fly   109 YNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKV 173
            .:|...|..||.|..:|.|:.::....||     |..|...||...:|::|..:|:.....|||.
Human   110 GSPCLLEALYRTESAYPQRLEIKPWKAYR-----DYRKEGYGLLILEGEDWQRVRSAFQKKLMKP 169

  Fly   174 QNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPD 238
            ..|.:...:::::..:|:.:::...:...|  ..|.:::|..|:||||..|....|.|||..|..
Human   170 GEVMKLDNKINEVLADFMGRIDELCDERGH--VEDLYSELNKWSFESICLVLYEKRFGLLQKNAG 232

  Fly   239 PNADRLAKHMRDFFNYSFQFDVQP---------SIWTFYKTAGFKKFLKTYDNITDITSNYIETA 294
            ..|......::...:...:..|.|         .:|..:..|        :|.|.......|:..
Human   233 DEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLA--------WDTIFKSVKACIDNR 289

  Fly   295 MRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRR 359
            :..:.:.......|.:......:||.....|.::.:|.::||:::.:.|||:|:|||..|:||.:
Human   290 LEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLK 354

  Fly   360 ELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMG 424
            |:..:||..:.... ::.:|||||:||:||.:|:|...|...|...|..||..|.:|:||.:::.
Human   355 EIQSVLPENQVPRA-EDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLN 418

  Fly   425 VLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEI 489
            ...|.:.:..|..||:|.|||||:.           ....|||.:||||.|.|.|||:|:|||::
Human   419 TQVLGSSEDNFEDSSQFRPERWLQE-----------KEKINPFAHLPFGVGKRMCIGRRLAELQL 472

  Fly   490 ETLLVRLLRSYKVSWLPETPIE--YESTIILS 519
            ...|..::|.|.:......|:|  :..|::.|
Human   473 HLALCWIVRKYDIQATDNEPVEMLHSGTLVPS 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 124/466 (27%)
CYP24A1NP_000773.2 p450 59..512 CDD:278495 129/480 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68094
Inparanoid 1 1.050 201 1.000 Inparanoid score I3707
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0001319
OrthoInspector 1 1.000 T130162
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.