DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and Cyp27b1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_034139.2 Gene:Cyp27b1 MGIID:1098274 Length:507 Species:Mus musculus

Alignment Length:489 Identity:141/490 (29%)
Similarity:225/490 (46%) Gaps:46/490 (9%)


  Fly    51 RSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFE 115
            ||..:|||||.|..|:.....|.|...:.:|::...|  ||.|:  .|..|....|:..:|...|
Mouse    35 RSLSDIPGPSTLSFLAELFCKGGLSRLHELQVHGAAR--YGPIW--SGSFGTLRTVYVADPTLVE 95

  Fly   116 MTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNVRQNL 180
            ...|.|...|.|....|...:|:.|:    :..|.|.:| |:||..:|:.:.|:|::.|......
Mouse    96 QLLRQESHCPERCSFSSWAEHRRRHQ----RACGLLTAD-GEEWQRLRSLLAPLLLRPQAAAGYA 155

  Fly   181 PQLDQISKEFIDKLETQRNPETHT--LTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNADR 243
            ..||.:.::.:.:|..||...:..  |..|...:...:..|||..|.|.:|:|.|.....|:.:.
Mouse   156 GTLDNVVRDLVRRLRRQRGRGSGLPGLVLDVAGEFYKFGLESIGAVLLGSRLGCLEAEVPPDTET 220

  Fly   244 LAKHMRDFFNYSFQFDVQPSIWTFYKTAG-FKKFLKTYDNITDITSNYI-----ETAMRGFGK-N 301
            ....:...|..:......|: |..:...| :.:..:.:|.:......::     |.|||..|| .
Mouse   221 FIHAVGSVFVSTLLTMAMPN-WLHHLIPGPWARLCRDWDQMFAFAQRHVELREGEAAMRNQGKPE 284

  Fly   302 DDGKTKCVLEQLLEHNKKVAVTMVM----DMLMAGIDTTSSACLTILYHLARNPSKQEKLRRELL 362
            :|..:...|...| ..:||:|..::    ::|:||:||.|:.....||.|:|:|..|..|..|  
Mouse   285 EDMPSGHHLTHFL-FREKVSVQSIVGNVTELLLAGVDTVSNTLSWTLYELSRHPDVQTALHSE-- 346

  Fly   363 RILPTTKDSLTDQN---TKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLMG 424
             |...|:.|....:   ...:|.|:|.|||.||:..:.|||.|:..:|:.:..|.:|:.|.|.:.
Mouse   347 -ITAGTRGSCAHPHGTALSQLPLLKAVIKEVLRLYPVVPGNSRVPDRDIRVGNYVIPQDTLVSLC 410

  Fly   425 VLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELEI 489
            ....|.|...|...:.|.|.|||.....|           :||..||||||.|:|||:|:||||:
Mouse   411 HYATSRDPTQFPDPNSFNPARWLGEGPTP-----------HPFASLPFGFGKRSCIGRRLAELEL 464

  Fly   490 ETLLVRLLRSYKVSWLPE---TPIEYESTIILSP 520
            :..|.::|..::|  |||   .||:..:..:|.|
Mouse   465 QMALSQILTHFEV--LPEPGALPIKPMTRTVLVP 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 134/471 (28%)
Cyp27b1NP_034139.2 p450 41..504 CDD:278495 138/484 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3781
Isobase 1 0.950 0 Normalized mean entropy S4820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130939
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.