DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and Cyp24a1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_034126.1 Gene:Cyp24a1 MGIID:88593 Length:514 Species:Mus musculus

Alignment Length:494 Identity:134/495 (27%)
Similarity:232/495 (47%) Gaps:55/495 (11%)


  Fly    49 QARSFGEIPGPS----LLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTY 109
            :.|:...:|||:    |..:|..|..||..:..:.:..   ..:.||.|:.:  .:|..::|...
Mouse    51 ETRNVTSLPGPTNWPLLGSLLEIFWKGGLKKQHDTLAE---YHKKYGQIFRM--KLGSFDSVHLG 110

  Fly   110 NPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQ 174
            :|...|..||.|...|.|:.::....||. ||.:.:    ||...:||||..:|:.....|||..
Mouse   111 SPSLLEALYRTESAHPQRLEIKPWKAYRD-HRNEAY----GLMILEGQEWQRVRSAFQKKLMKPV 170

  Fly   175 NVRQNLPQLDQISKEF---IDKLETQRNPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDN 236
            .:.:...:::::..:|   ||:|..:|.     ...|.:::|..|:||||..|....|.|||..:
Mouse   171 EIMKLDKKINEVLADFMGQIDELRDERG-----RIQDLYSELNKWSFESICLVLYEKRFGLLQKD 230

  Fly   237 PDPNADRLAKHMRDFFNYSFQFDVQP---------SIWTFYKTAGFKKFLKTYDNITDITSNYIE 292
            .:..|......::...:...:..|.|         .:|..:..|        :|.|.......|:
Mouse   231 TEEEALTFIAAIKTMMSTFGKMMVTPVELHKRLNTKVWQAHTLA--------WDTIFKSVKPCID 287

  Fly   293 TAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKL 357
            ..:..:.:.......|.:.|....:||.....|.::.:|.::||:::.:.|||:|:|||..|::|
Mouse   288 HRLERYSQQPGADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQRL 352

  Fly   358 RRELLRILPTTKDSLTD--QNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTG 420
            .||:..:||   |:.|.  ::.:|||||:||:||.:|:|...|...|...|..||..|.:|:||.
Mouse   353 LREIQSVLP---DNQTPRAEDVRNMPYLKACLKESMRLTPSVPFTTRTLDKPTVLGEYTLPKGTV 414

  Fly   421 VLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIA 485
            :.:....|.:.:..|..:.:|.|||||:.:           :..|||.:||||.|.|.|||:|:|
Mouse   415 LTLNTQVLGSSEDNFEDADKFRPERWLEKE-----------KKINPFAHLPFGVGKRMCIGRRLA 468

  Fly   486 ELEIETLLVRLLRSYKVSWLPETPIEYESTIILSPCGDI 524
            ||::...|..:::.|.:......|:|.....||.|..::
Mouse   469 ELQLHLALCWIIQKYNIVATDSEPVEMLHLGILVPSREL 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 127/470 (27%)
Cyp24a1NP_034126.1 p450 59..513 CDD:278495 133/487 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68094
Inparanoid 1 1.050 196 1.000 Inparanoid score I3781
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0001319
OrthoInspector 1 1.000 T130939
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.