DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and Cyp27b1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_446215.1 Gene:Cyp27b1 RGDID:69192 Length:501 Species:Rattus norvegicus

Alignment Length:490 Identity:140/491 (29%)
Similarity:226/491 (46%) Gaps:47/491 (10%)


  Fly    51 RSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDFE 115
            ||..:|||||....|:.....|.|...:.:|::...|  ||.|:  .|..|....|:..:|...|
  Rat    28 RSLSDIPGPSTPSFLAELFCKGGLSRLHELQVHGAAR--YGPIW--SGSFGTLRTVYVADPALVE 88

  Fly   116 MTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQEWADIRNKVNPVLMKVQNVRQNL 180
            ...|.|...|.|....|.:.:|:.|:    :..|.|.:| |:||..:|:.:.|:|::.|......
  Rat    89 QLLRQESHCPERCSFSSWSEHRRRHQ----RACGLLTAD-GEEWQRLRSLLAPLLLRPQAAAGYA 148

  Fly   181 PQLDQISKEFIDKLETQRN-----PETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPN 240
            ..||.:..:.:.:|..||.     |:   |..|...:...:..|.|..|.|.:|:|.|.....|:
  Rat   149 GTLDSVVSDLVRRLRRQRGRGSGLPD---LVLDVAGEFYKFGLEGIGAVLLGSRLGCLEAEVPPD 210

  Fly   241 ADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAG-FKKFLKTYDNITDITSNYI-----ETAMRGFG 299
            .:...:.:...|..:......|| |......| :.:..:.:|.:......::     |.|:|..|
  Rat   211 TETFIEAVGSVFVSTLLTMAMPS-WLHRLIPGPWARLCRDWDQMFAFAQKHVEQREGEAAVRNQG 274

  Fly   300 K-NDDGKTKCVLEQLLEHNKKVAVTMVM----DMLMAGIDTTSSACLTILYHLARNPSKQEKLRR 359
            | .:|..|...|...| ..:||:|..::    ::|:||:||.|:.....||.|:|:|..|..|..
  Rat   275 KPEEDLPTGHHLTHFL-FREKVSVQSIVGNVTELLLAGVDTVSNTLSWALYELSRHPEVQSALHS 338

  Fly   360 ELL-RILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFRITPKDLVLSGYQVPRGTGVLM 423
            |:. .:.|.:...|.......:|.|:|.|||.||:..:.|||.|:..:|:.:..|.:|:.|.|.:
  Rat   339 EITGAVNPGSYAHLQATALSQLPLLKAVIKEVLRLYPVVPGNSRVPDRDICVGNYVIPQDTLVSL 403

  Fly   424 GVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELE 488
            .....|.|...|.:.:.|.|.|||....||           :||..||||||.|:|||:|:||||
  Rat   404 CHYATSRDPAQFREPNSFNPARWLGEGPAP-----------HPFASLPFGFGKRSCIGRRLAELE 457

  Fly   489 IETLLVRLLRSYKVSWLPE---TPIEYESTIILSP 520
            ::..|.::|..::|  |||   .|::..:..:|.|
  Rat   458 LQMALAQILTHFEV--LPEPGALPVKPMTRTVLVP 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 133/472 (28%)
Cyp27b1NP_446215.1 p450 34..498 CDD:278495 137/485 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I3652
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131183
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.