DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and Cyp27a1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_077226.2 Gene:Cyp27a1 MGIID:88594 Length:533 Species:Mus musculus

Alignment Length:493 Identity:137/494 (28%)
Similarity:231/494 (47%) Gaps:41/494 (8%)


  Fly    51 RSFGEIPGPSLLRML-SFFMPGGALRNTNLIQMNRLMREMYGDIYCIPGMMGKPNAVFTYNPDDF 114
            ||..|:||...|:.| ..|:.|..|...:|..:|   :..||.::..  ..|....|...:....
Mouse    57 RSPAELPGTGTLQFLFQLFLQGYVLHLPDLQVLN---KTKYGPMWTT--SFGTYTNVNLASAPLL 116

  Fly   115 EMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVG-GLASDQGQEWADIRNKVNPVLMKVQNVRQ 178
            |...|.||.:|||..::..    |.||.  .||:. |:...||::|..:|..:...|:|......
Mouse   117 EQVMRQEGKYPIRDHMDQW----KDHRD--HKGLTYGIFIAQGEQWYHLRQALKQRLLKPDEAAL 175

  Fly   179 NLPQLDQISKEFIDKLETQR-NPETHTLTTDFHNQLKMWAFESISFVALNTRMGLLSDNPDPNAD 242
            ....|:::..:||.:|:..| ..|:.....|..:.|...|.|:|:::....|:|.|..:...:..
Mouse   176 YTDALNEVISDFITRLDQVRAESESGDQVPDMAHLLYHLALEAITYILFEKRIGCLKPSIPEDTA 240

  Fly   243 RLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDITSNYIETAMRGF--------- 298
            ...:.:...|..|......|. ||......:|::|..:|||.......|:..::..         
Mouse   241 AFIRSVAIMFQNSVYITFLPK-WTRPLLPFWKRYLNGWDNIFSFGKKLIDEKVQELKAQLQETGP 304

  Fly   299 -GKNDDGKTKCVL-EQLLEHNKKVAVTMVMDMLMAGIDTTSSACLTILYHLARNPSKQEKLRREL 361
             |....|....:| .:||...:.:..  ..::|:||:||||:.....||||:::|..||.|.:|:
Mouse   305 DGVRVSGYLHFLLTNELLSTQETIGT--FPELLLAGVDTTSNTLTWALYHLSKSPEIQEALHKEV 367

  Fly   362 LRILPTTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFR-ITPKDLVLSGYQVPRGTGVLMGV 425
            ..::|..|.. ..::..:||.|:|.|||.||:..:.|.|.| ||.|:..::|:..|:.|..::..
Mouse   368 TGVVPFGKVP-QHKDFAHMPLLKAVIKETLRLYPVVPTNSRIITEKETEINGFLFPKNTQFVLCH 431

  Fly   426 LELSNDDKYFAQSSEFIPERWLKSDLA--PDIQACPAARTRNPFVYLPFGFGPRTCIGKRIAELE 488
            ..:|.|...|.:.:.|.|.|||:...|  |.|        .:||..:|||:|.|:|:|:||||||
Mouse   432 YVVSRDPSVFPEPNSFQPHRWLRKKEADNPGI--------LHPFGSVPFGYGVRSCLGRRIAELE 488

  Fly   489 IETLLVRLLRSYKVSWLPET-PIEYESTIILSPCGDIR 525
            ::.:|.||::.|:::..|.. .::..|.|:|.|...:|
Mouse   489 MQLMLSRLVQKYEIALAPGMGEVKTVSRIVLVPSKKVR 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 127/470 (27%)
Cyp27a1NP_077226.2 p450 82..527 CDD:278495 127/469 (27%)
Sterol-binding. {ECO:0000255} 386..400 8/14 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3781
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130939
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.