DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and cyp24a1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_012808417.1 Gene:cyp24a1 XenbaseID:XB-GENE-479201 Length:502 Species:Xenopus tropicalis

Alignment Length:508 Identity:131/509 (26%)
Similarity:229/509 (45%) Gaps:58/509 (11%)


  Fly    21 NRNSSVGGTLSQQTQL-ELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNR 84
            :|:.||..::...|.: :|.:..:........|...:|||:.|.:|...:  ..||...|.:.:.
 Frog    16 SRSISVQHSIPTATAVCDLKEKELPAPSSCPHSLAALPGPTKLPILGSLL--DILRKGGLKRQHE 78

  Fly    85 LMREMYGDIYCIPGMMGKP--NAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKG 147
            .:...:       ...||.  ::|....|...|..||.|..:|.|:.::....||. :|.:.:  
 Frog    79 ALASYH-------KQFGKXSFDSVHIGAPCLLEALYREESNYPKRLEIKPWKAYRD-YRDEAY-- 133

  Fly   148 VGGLASDQGQEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPETHTLTTDFHNQ 212
              ||...:|::|..:|:.....|||...|.:...:::::..:|:.::::..: |..|: .|.:.:
 Frog   134 --GLLILEGKDWQRVRSAFQQKLMKPTEVGKLDTKINEVLVDFMKRIDSVCD-EDGTI-EDLYCE 194

  Fly   213 LKMWAFESISFVALNTRMGLLSDNPDPNADRL---AKHMRDFFNYSFQFDVQ------PSIWTFY 268
            |..|:.|||..|....|.|.|..|....|...   .|.|...|.......|:      ..||   
 Frog   195 LNKWSLESICLVLYEKRFGFLQPNLGEEAQNFITAIKMMMSTFGLMMVTPVELHKSLNTKIW--- 256

  Fly   269 KTAGFKKFLKTYDNITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKVAVTMVMDMLMAGI 333
                 |.....:|:|......:|:..:............|.:....:.:||.....:.:||:..:
 Frog   257 -----KDHTHAWDSIFKTAKCHIDRRLTKLSSKGSEDFLCTIYNDSKLSKKEMYATITEMLIGAV 316

  Fly   334 DTTSSACLTILYHLARNPSKQEKLRRELLRIL-----PTTKDSLTDQNTKNMPYLRACIKEGLRI 393
            :||:::.|..:::::|||..|:||..|:..:|     ||..|      .:|||||:||:||.:||
 Frog   317 ETTANSLLWAIFNISRNPHIQKKLLEEIESVLLPDQVPTADD------IRNMPYLKACLKESMRI 375

  Fly   394 TSITPGNFRITPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQAC 458
            |...|...|...|:.||..|.:|:||.:.:....|.::.:.|...::|.|||||:.         
 Frog   376 TPSIPFTTRTLDKETVLGDYVLPKGTVLTINSHVLGSNQECFDNWNQFRPERWLQQ--------- 431

  Fly   459 PAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPETPIE 511
              ..|.|||.::|||.|.|.|||:|:|||:::..|..|:|.|::......|:|
 Frog   432 --KNTINPFAHVPFGIGKRMCIGRRLAELQLQLTLCWLIRKYEIVATDNDPVE 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 122/468 (26%)
cyp24a1XP_012808417.1 p450 53..490 CDD:278495 125/472 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 1 1.000 FOG0001319
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.