DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and cyp27a1

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_002934001.2 Gene:cyp27a1 XenbaseID:XB-GENE-5871552 Length:518 Species:Xenopus tropicalis

Alignment Length:493 Identity:133/494 (27%)
Similarity:238/494 (48%) Gaps:44/494 (9%)


  Fly    29 TLSQQTQLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYGDI 93
            |:.::..|.::.:.:.| .:..::..::||||.|::|.:....|.|..|:.:|:  :.|:.||.:
 Frog    24 TVRKKATLGVSGATVVE-GKTLKTLDDLPGPSPLKLLYWIFLRGYLFRTHELQV--IFRKTYGPM 85

  Fly    94 YCIPGMMGKPNAVFTY-NPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQGQ 157
            :   .|..:.:|:.|. :||..|...|.||.:|.|..:    :..:.|| |:.....|..:::|.
 Frog    86 W---KMSDRQHAMVTVASPDLLESLLRKEGKYPTRADM----FIMREHR-DLRGHSYGPVTEEGH 142

  Fly   158 EWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKL-ETQRNPETHTLTTDFHNQLKMWAFESI 221
            :|..||..:|..::|.:........::::..:.:.|: |......:.|........:..:|||||
 Frog   143 QWHRIRTILNQRMLKPRETVVYAGSMNEVVSDLLLKIKELTAQSSSGTQVNGVAELMYKFAFESI 207

  Fly   222 SFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSIWTFYKTAGFKKFLKTYDNITDI 286
            ..|...||:|.|:....|...:....:.....:.......|. ||......:.::::.:|.|.|.
 Frog   208 CTVLFETRLGCLNKEILPETQKFIDSIGIMLEHLTMLTRLPQ-WTKGILPYWGRYIEAWDTIFDF 271

  Fly   287 TSNYIETAMRGF------GKNDDGKTKCVLEQLLEHNK---KVAVTMVMDMLMAGIDTTSSACLT 342
            ....|:..|...      |:..:|:   .|..||...|   :.....|:::|.||:||||:....
 Frog   272 GKKLIDKKMEDIEGRLKRGEEVEGE---YLTYLLSSGKLSMEEVYGSVVELLQAGVDTTSNTLTW 333

  Fly   343 ILYHLARNPSKQEKLRRELLRILP--TTKDSLTDQNTKNMPYLRACIKEGLRITSITPGNFR-IT 404
            .||.|:|||..|..|.:|::|::|  |..||   :....||.|:|.|||.||:..:.|.|.| |.
 Frog   334 ALYQLSRNPEIQNNLYQEVIRVIPGETIPDS---EAIARMPLLKAVIKETLRLFPVVPENARMIN 395

  Fly   405 PKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQACPAARTRNPFVY 469
            .|::.:..|..|..|..::|...:|.|:..|.::..|:|||||:.          :....:||..
 Frog   396 EKEVTIKDYVFPVKTQFILGHYAISRDETTFPEADRFLPERWLRD----------SGMKHHPFGS 450

  Fly   470 LPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPE 507
            :|||:|.|.|:|:||||||:...|.|:::.::|  :|:
 Frog   451 IPFGYGVRACVGRRIAELEMHLALSRIIKMFQV--IPD 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 128/464 (28%)
cyp27a1XP_002934001.2 p450 51..488 CDD:278495 130/466 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.