DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp12b2 and LOC100145331

Sequence 1:NP_611370.2 Gene:Cyp12b2 FlyBaseID:FBgn0034387 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_002933986.2 Gene:LOC100145331 XenbaseID:XB-GENE-984298 Length:557 Species:Xenopus tropicalis

Alignment Length:518 Identity:144/519 (28%)
Similarity:253/519 (49%) Gaps:60/519 (12%)


  Fly    27 GGTLSQQTQLELADSRIDEKWQQARSFGEIPGPSLLRMLSFFMPGGALRNTNLIQMNRLMREMYG 91
            |.::||...:..|.....|..::.:.|.::||||||:.|.::...|.|.:|:.:|:  :.::|||
 Frog    60 GASVSQGRAVTGAAVGATEGRKEMKEFEDLPGPSLLKNLYYYFLRGYLLHTHELQL--IYKKMYG 122

  Fly    92 DIYCIPGMMGKPNAVFTYNPDDFEMTYRNEGVWPIRIGLESLNYYRKIHRPDVFKGVGGLASDQG 156
            .::  ...:||...|...:|:..:...|.||.:|:|    :.....|.|| |..|...|..:::|
 Frog   123 PLW--RSEIGKYKMVNIADPEVLQRLVRQEGKYPMR----NKEDVWKAHR-DKRKLAYGPFTEEG 180

  Fly   157 QEWADIRNKVNPVLMKVQNVRQNLPQLDQISKEFIDKLETQRNPE-THTLTTDFHNQLKMWAFES 220
            .:|..||:.:|..::|..........::::..:|:|:|:..|... :..:..|..|.|..:|||.
 Frog   181 HQWYQIRSALNKKMLKPSEAASYAGGINEVVTDFMDRLQDMRKASPSGDMVNDLANALYRFAFEG 245

  Fly   221 ISFVALNTRMGLLSDNPDPNADRLAKHMRDFFNYSFQFDVQPSI---WTFYKTAGFKKFLKTYDN 282
            ||.:...||:|.|.....|...:..    |...|.|:..|..:.   ||......:.::::.:||
 Frog   246 ISNIVFETRIGCLDKQIPPETQKFI----DSIGYMFKNSVYVTFLPHWTRGILPYWDRYIEGWDN 306

  Fly   283 ITDITSNYIETAMRGFGKNDDGKTKCVLEQLLEHNKKVA------------VTM------VMDML 329
            |.|            |||:...|....::..|:..::|.            :||      |.::|
 Frog   307 IFD------------FGKHLIDKKMSEIQSRLDKGEEVEGEYLTYLLSSANLTMGEVYGSVCELL 359

  Fly   330 MAGIDTTSSACLTILYHLARNPSKQEKLRRELLRILPTTKDSLTDQNTKNMPYLRACIKEGLRIT 394
            :||:||||:.....:|||||:|..|:.:..|:....|..:..:. ::..|||.||..|||.||:.
 Frog   360 LAGVDTTSNTLCWAMYHLARDPELQQAVYEEVSSAAPMDRIPVA-EDIPNMPLLRGVIKETLRLY 423

  Fly   395 SITPGNFRI-TPKDLVLSGYQVPRGTGVLMGVLELSNDDKYFAQSSEFIPERWLKSDLAPDIQAC 458
            .:.|.|.|| :.|::.:..|:.|:.|..::....::.|::.|....:|.|:|||:.         
 Frog   424 PVIPTNARIVSEKEVEIGEYRFPKNTLFVLSHYAIARDEENFEDPLKFKPQRWLRD--------- 479

  Fly   459 PAARTRNPFVYLPFGFGPRTCIGKRIAELEIETLLVRLLRSYKVSWLPE-TPIEYESTIILSP 520
             .....:||..:|||:|.|.|:||||||||:...|.|::|.:::.|.|: ..|:..:.|:|||
 Frog   480 -GGMKHHPFSSIPFGYGVRACLGKRIAELEMHLALSRVIRMFELRWDPKGEDIKSIARIVLSP 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp12b2NP_611370.2 p450 59..511 CDD:299894 132/476 (28%)
LOC100145331XP_002933986.2 p450 90..549 CDD:278495 138/489 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.