DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17821 and CG31523

Sequence 1:NP_725820.2 Gene:CG17821 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster

Alignment Length:257 Identity:78/258 (30%)
Similarity:127/258 (49%) Gaps:34/258 (13%)


  Fly    21 MFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIF---LMGTYYLF 82
            :..:|||.:.:.:.|......:||..|..|||..:|..:::||..|.:.::.||   ||..::  
  Fly    29 LLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWW-- 91

  Fly    83 IKKLYDFRC-----------MTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQIT 136
              ..|..:|           |.|::           :.::|:|:|..:..||:||:|||.|:.::
  Fly    92 --GHYSLKCQPVDYSTTGLAMRMVN-----------ICWWYYISKFTEFFDTLFFILRKKNEHVS 143

  Fly   137 VLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYIT 201
            .|||.||..|...|.:...| .|||.......||||||:|||.||..:|..|..:...|||:|:|
  Fly   144 TLHVIHHGCMPFSVWMGLKF-APGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLT 207

  Fly   202 KLQFLQFMILFAQSVLTLWLNPGCRFPK-VLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKEQ 262
            ..|.:||:.:|......|:..  |.:|| .:.::.|.| |..:.:|.:||...|:.|..:.:
  Fly   208 TFQMVQFVAIFTHQFQLLFRE--CDYPKGFMVWIGLHG-VMFLFLFSDFYKAKYLNAARRRR 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17821NP_725820.2 ELO 20..262 CDD:279492 78/256 (30%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62563205
eggNOG 1 0.900 E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094172at2759
OrthoFinder 1 1.000 FOG0000111
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11157
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.