DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps51 and AT4G02030

Sequence 1:NP_611363.2 Gene:Vps51 FlyBaseID:FBgn0034380 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001190654.1 Gene:AT4G02030 AraportID:AT4G02030 Length:805 Species:Arabidopsis thaliana

Alignment Length:822 Identity:207/823 (25%)
Similarity:368/823 (45%) Gaps:180/823 (22%)


  Fly     9 FD-MDSSSFDAEKYLERL-------------------------LKDCSLKQIMDTEAAVVKDTQT 47
            || ::|:||||::|::.:                         :|..:|:.::.....:..:.:.
plant    40 FDNINSTSFDADQYMDLMIRLFDLGLSDLPAMVDSSELNWVYEIKKSNLEVLLQRHVQMAAEIKN 104

  Fly    48 LHSDMQTLVYENYNKFISATDTIRRMKDDFKQMETDVNLLMTKMQSITTFSEQITGTLQGTRSQL 112
            |.:|:|.||||||||||||||||:|||.:...||.:::.|:.|:.|:.:.|:.:..:|...|..:
plant   105 LDTDLQMLVYENYNKFISATDTIKRMKSNIFGMEGNMDQLLQKIMSVQSKSDGVNTSLFEKREHI 169

  Fly   113 CRLSEKHSLLKRLQFLSTLPAKLKSLIEEQNYAQAVQDYLHAQKVFAQYGRQPSFDGIQRDC--- 174
            .:|....:||:::||:..|||:|:..|:.:.|..||:.|..|..:...|| ..||    :||   
plant   170 EKLHRTRNLLRKVQFIYDLPARLQKCIKSEAYGDAVRFYTGAMPILKVYG-DTSF----QDCRRA 229

  Fly   175 -----DAIMADLKEQLRSDFQRAGNTAQSLTEIGELLLQLDEKTSDLASEMLTCAGKRLHEQIVM 234
                 :.|:.:|:.:|.||    ..:.|:..|...||.|||.....|.:::|    ::|.:.:..
plant   230 SEEAIEIIIKNLQTKLFSD----SESIQARAEAAVLLKQLDVPVDSLKAKLL----EKLEQSLDG 286

  Fly   235 LQDQTER--DMLEFVDMGIDGFLND-------------LALVVTSYFDMF--------------V 270
            ||.:.|.  .::|..|...|...||             .:..:.:|.::|              .
plant   287 LQIKPEEASTLVEDDDSSNDTESNDQHPAKIHEDAVRGFSEAIRAYREIFPDSEERLFKLARALT 351

  Fly   271 AKHYEHERDDFQE--NALQELNVF--LNQNIEKYLTLVQDRVESDIGYGDTQVMLRA-LDRLHRR 330
            |.|:|:.....::  :|...|.:|  :.:::.....::.:...||:.....||.|:. :.|:...
plant   352 AMHFEYMELYIKKRVSAADFLGIFRIVWEDVVLMDEVLPEAALSDLSAEAAQVTLKQFVARMFSH 416

  Fly   331 LQAMRNICRGL---------EVQRNTVSIIISAAHQLCDAHAKNLKDHFADSLSAVRLSLVSAKS 386
            ||  ::|...|         .|:...:.:::.|:.:.......|:...|...|            
plant   417 LQ--QDISDTLLKFDINQKEAVEGELLKVVLEASQKAVLQGTTNIFQDFRQLL------------ 467

  Fly   387 DAAAGLNLGDLISNLYVSMVEKIKGVLQDLLIFLRTDWSFNIKAEHKGALCVEGIRENLLIGFLR 451
                     |..:.:::.|.:.|.|.:|                  ||:.           .|.|
plant   468 ---------DEKTGIFIKMKDLISGWIQ------------------KGSQ-----------DFFR 494

  Fly   452 HI-AKVMCGFGDASSSSP----------PNLLLVLSKTCLELEQQGVHILIALVDDL-YEIDSEN 504
            .: |:.:...|..|||:.          ..|:|||::..:.:||:   ::..:.::: ......|
plant   495 SLEAQFLVLSGKTSSSNDIEGKSSDKIHAGLILVLAQLSVFIEQK---VIPRVTEEIAASFSGGN 556

  Fly   505 SATLTH-----ETEICAEMRETAQSLLDAYVRLQGTNISQMLRKSVETRDWLNCLEPRSVRAVMK 564
            |....:     ..|:|......::.||..|:..:...:|.:|||..:|.:|:...|||.|...:.
plant   557 SQAFENGPAFIPGELCRVFHAASEKLLQHYIDTRTQKVSVLLRKRFKTPNWVKHKEPREVHMYVD 621

  Fly   565 RVVEELGSIETVVASLYEANT------NATSGFRTTASSDSSRKTYFSNFASTSKPQYRSNWSNY 623
            ..:.||..:...|..:....|      ..::|..||.||.       ||.....| ..||| |..
plant   622 MFLHELEEVGKEVKQVLPQGTFRKHKRTDSNGSNTTTSSR-------SNTLHNDK-MARSN-SQR 677

  Fly   624 TPSQLESSYVSNIHRLFSERVEIFTSVEFTKASIIMGIIKIGLKTLLECVRLRTFSKFGLQQIQV 688
            ..|||   :.:::.:||.::|||||.||||:.|::...:|:.||:|.|.|||:||::.|.||||:
plant   678 ARSQL---FETHLAKLFKQKVEIFTKVEFTQESVVTTTVKLCLKSLQEYVRLQTFNRSGFQQIQL 739

  Fly   689 DAHYLQMNLWRFVSDENLVNFLLDEILGSAVQRCLESVLMEP 730
            |..:|:..|...|.||..::|||||::.:|.:|||:.:.:||
plant   740 DIQFLKAPLKEAVEDEAAIDFLLDEVIVAASERCLDVIPLEP 781

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps51NP_611363.2 Vps51 11..96 CDD:285862 35/110 (32%)
Dor1 50..210 CDD:302817 61/168 (36%)
AT4G02030NP_001190654.1 Vps51 83..153 CDD:285862 29/70 (41%)
Dor1 108..293 CDD:302817 68/198 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 209 1.000 Inparanoid score I1224
OMA 1 1.010
OrthoDB 1 1.010 D1305393at2759
OrthoInspector 1 1.000 T192975
orthoMCL 1 0.900 OOG5_130453
Panther 1 1.100 LDO PTHR15954
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.