DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps51 and Vps51

Sequence 1:NP_611363.2 Gene:Vps51 FlyBaseID:FBgn0034380 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001074510.1 Gene:Vps51 MGIID:1915755 Length:782 Species:Mus musculus

Alignment Length:744 Identity:315/745 (42%)
Similarity:460/745 (62%) Gaps:30/745 (4%)


  Fly     7 NPFDMDSSSFDAEKYLERLLKDCSLKQIMDTEAAVVKDTQTLHSDMQTLVYENYNKFISATDTIR 71
            :|.|::.:.||.|.||::|.::|.|.|:||:|..:|:..:.|.||||||||||||||||||||||
Mouse    59 DPTDLNGAHFDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISATDTIR 123

  Fly    72 RMKDDFKQMETDVNLLMTKMQSITTFSEQITGTLQGTRSQLCRLSEKHSLLKRLQFLSTLPAKLK 136
            :||:||::||.:::.|.|.|..||.||.:|:.|||....::.:|:..|:||::||||..||::|.
Mouse   124 KMKNDFRKMEDEMDRLATNMAVITNFSARISATLQDRHERITKLAGVHALLRKLQFLFELPSRLT 188

  Fly   137 SLIEEQNYAQAVQDYLHAQKVFAQYGRQPSFDGIQRDCDAIMADLKEQLRSDFQRAGNTAQSLTE 201
            ..:|...|.|||:....|:.|..||...|||..||.||..|.|.|.:|||..|:...:.|....|
Mouse   189 KCVELGAYGQAVRYQGRARAVLQQYQHLPSFRAIQDDCQVITARLAQQLRQRFREGCSGAPEQAE 253

  Fly   202 IGELLLQLDEKTSDLASEMLTCAGKRLHEQIVMLQDQ-----TERDMLEFVDMGIDGFLNDLALV 261
            ..||||.|.|...:|..|.|..|..||.|::..|:.:     ...|:|||.|.|.:||:..|..|
Mouse   254 CVELLLALGEPAEELCEEFLAHARGRLEEELSSLEAELGPSPPAPDVLEFTDRGGNGFVGGLCQV 318

  Fly   262 VTSYFDMFVAKHYEHERDDFQENALQELNVFLNQNIEKYLTLVQDRVESDIGYGDTQVMLRALDR 326
            ..:|.::|.|:         .....::|..|..:...:|..||:.|:..:.|..|..:::|||||
Mouse   319 AAAYQELFAAQ---------GPAGAEKLAAFAQELGGRYFALVERRLAQEQGGSDNSLLVRALDR 374

  Fly   327 LHRRLQAMRNICRGLEVQRNTVSIIISAAHQLCDAHAKNLKDHFADSLSAVRLSLVSAKSDAAAG 391
            .||||:|...:.....:..:...|:...|.:....|.:.||..|..||:.||.:|.:.:.....|
Mouse   375 FHRRLRAPGALLAAAGLSESATEIVERVARERLSHHLQGLKAAFLSSLTDVRQALAAPRLAGKEG 439

  Fly   392 LNLGDLISNLYVSMVEKIKGVLQDLLIFLRTDWSFNIKAEHKGALCVEGIRENLLIGFLRHIAKV 456
            .:|.:|::|:..|::..||..|..:.:|...:.||:.|...:|..|.:|:||.|::||:|.:.:.
Mouse   440 PSLAELLANVASSILSHIKTSLASVHLFTAKEVSFSNKPYFRGEFCSQGVREGLIVGFIRSMCQT 504

  Fly   457 MCGF----GDASSSSPPNLLLVLSKTCLELEQQGVHILIALVDDLYEIDSENSATLTHETEICAE 517
            ...|    |:...::||.|||:||:.||:.|...:..::.|.|:.:.:  ::.:.:|..:.:|||
Mouse   505 AQSFCDSPGEKGGATPPALLLLLSRLCLDYETATISYILTLTDEQFLV--QDQSPVTPVSTLCAE 567

  Fly   518 MRETAQSLLDAYVRLQGTNISQMLRKSVETRDWLNCLEPRSVRAVMKRVVEELGSIETVVASLYE 582
            .||||:.||..||::||..|||||||||||||||:.||||:||||||||||:..:|:..|..|||
Mouse   568 ARETARRLLTHYVKVQGLVISQMLRKSVETRDWLSTLEPRNVRAVMKRVVEDTTAIDVQVGLLYE 632

  Fly   583 ANTNATSGFRTTASSDSSRKTYFSNFASTSKPQYRSNWSNYTPS-QLESSYVSNIHRLFSERVEI 646
                  .|.|...|||||::|:....:|..:.:|.   .:|||| .::::.:|||.:|||||:::
Mouse   633 ------EGVRKAQSSDSSKRTFSVYSSSRQQGRYA---PSYTPSAPMDTNLLSNIQKLFSERIDV 688

  Fly   647 FTSVEFTKASIIMGIIKIGLKTLLECVRLRTFSKFGLQQIQVDAHYLQMNLWRFVSDENLVNFLL 711
            |:.|||.|.|::.|||||.|||||||||||||.:|||||:|||.|:||:.|||||:||.||:.||
Mouse   689 FSPVEFNKVSVLTGIIKISLKTLLECVRLRTFGRFGLQQVQVDCHFLQLYLWRFVADEELVHLLL 753

  Fly   712 DEILGSAVQRCLESVLMEPNAVEIICERG 740
            ||::.||..||.:.|.|||:.||:|||||
Mouse   754 DEVVASAALRCPDPVPMEPSVVEVICERG 782

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps51NP_611363.2 Vps51 11..96 CDD:285862 47/85 (55%)
Dor1 50..210 CDD:302817 80/160 (50%)
Vps51NP_001074510.1 Vps51 63..147 CDD:285862 46/84 (55%)
Dor1 101..262 CDD:302817 80/161 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293556757
eggNOG 1 0.900 E1_KOG2346
Hieranoid 1 1.000
Homologene 1 1.000 H34675
Inparanoid 1 1.050 562 1.000 Inparanoid score I1077
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005305
OrthoInspector 1 1.000 T1083396
orthoMCL 1 0.900 OOG5_130453
Panther 1 1.100 LDO PTHR15954
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2898
TreeFam 1 0.960
1211.880

Return to query results.
Submit another query.