DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps51 and vps51

Sequence 1:NP_611363.2 Gene:Vps51 FlyBaseID:FBgn0034380 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001036200.1 Gene:vps51 ZFINID:ZDB-GENE-030131-6008 Length:827 Species:Danio rerio

Alignment Length:797 Identity:346/798 (43%)
Similarity:493/798 (62%) Gaps:74/798 (9%)


  Fly     7 NPFDMDSSSFDAEKYLERLLKDCSLKQIMDTEAAVVKDTQTLHSDMQTLVYENYNKFISATDTIR 71
            :|.|::...||.|.||.:|.|:|||.::||.|:.:||..::|.||||||||||||||||||||||
Zfish    42 DPCDINGPHFDPEIYLNKLRKECSLTELMDHESCMVKQIRSLDSDMQTLVYENYNKFISATDTIR 106

  Fly    72 RMKDDFKQMETDVNLLMTKMQSITTFSEQITGTLQGTRSQLCRLSEKHSLLKRLQFLSTLPAKLK 136
            :||:|||:||.:::.|...|.:||.||.:|:||||...:|:.:||..|:||::||||..|||:|.
Zfish   107 KMKNDFKKMEDEMDCLSANMAAITEFSARISGTLQDQHAQITKLSGVHTLLRKLQFLFELPARLN 171

  Fly   137 SLIEEQNYAQAVQDYLHAQKVFAQYGRQPSFDGIQRDCDAIMADLKEQLRSDFQRAGNTAQSLTE 201
            ..:|.|.|||||..:..|:.|..||...|||.|||.||..||..|.:|||..|:..|::|:.|:|
Zfish   172 KCLELQAYAQAVSSHRRARCVLQQYSHMPSFRGIQDDCHVIMEQLAQQLRQKFRDGGSSAKDLSE 236

  Fly   202 IGELLLQLDEKTSDLASEMLTCAGKRLHEQIVMLQDQTE-------------------------- 240
            ..||||||||...:|..:.|:.|..||...:..|:.:.:                          
Zfish   237 CVELLLQLDEPAEELCDKFLSHAQSRLEADLQGLEAELKDSAVTDTGAGSVQKTSPGSNPVSPSS 301

  Fly   241 ------------RDMLEFVDMGIDGFLNDLALVVTSYFDMFVAKHYEHE--RDDFQENALQELNV 291
                        .|:|||:|.|.:.|:::|.||:.||.::|:.:..|.|  ..:..|.|..:|:|
Zfish   302 SVSNPFLSPAAGTDILEFIDRGCNEFVSNLCLVIASYQELFINRPQESELASKNIPEMANGKLHV 366

  Fly   292 FLNQNIEKYLTLVQDRVESDIGYGDTQVMLRALDRLHRRLQAMRNICRGLEVQRNTVSIIISAAH 356
            |::....:|.:||:.|::.:.|.||..:::|||||.||||||:..:..|..|......|::.||.
Zfish   367 FVDTLAARYFSLVERRIQEEKGVGDNSLLVRALDRFHRRLQAISKLLPGSAVPSQGTEIVVRAAR 431

  Fly   357 QLCDAHAKNLKDHFADSLSAVRL------------------SLVSAKSDAAAGLNLGDLISNLYV 403
            :....:...|:..:.|||:.||.                  :||...|...|..:|.:|:::|..
Zfish   432 ERIKQYLSALQTFYHDSLTDVRQALAAPRLSVGGASASGGGALVGGASSKDAPPSLPELLTSLSN 496

  Fly   404 SMVEKIKGVLQDLLIFLRTDWSFNIKAEHKGALCVEGIRENLLIGFLRHI---AKVMC-GFGDAS 464
            .::.::|.||..:.:|...|.:|:.|...||..|.:|:||.|::.|::.|   ::..| ..||..
Zfish   497 FILNQLKSVLASVHLFTAKDITFSNKPYFKGEFCSQGVREGLVVSFIKFICQSSRQYCESAGDRG 561

  Fly   465 SSSPPNLLLVLSKTCLELEQQGVHILIALVDDLYEIDSENSATLTHETEICAEMRETAQSLLDAY 529
            .|:||.|||:||:.||:.|...:..::.|.|:.:.:  ::...:|..|.:|||.||.||.||:.|
Zfish   562 GSTPPALLLLLSRLCLDYETSTISYILTLTDEQFLV--QHHTPVTPVTALCAEAREAAQKLLNHY 624

  Fly   530 VRLQGTNISQMLRKSVETRDWLNCLEPRSVRAVMKRVVEELGSIETVVASLYEANTNATSGFRTT 594
            |::||..||||||||||||||:|.:|||:||||||||||:..||:..|..|||      .|.|..
Zfish   625 VKVQGLIISQMLRKSVETRDWVNTIEPRNVRAVMKRVVEDTTSIDVQVGLLYE------EGVRKA 683

  Fly   595 ASSDSSRKTYFSNFASTSKPQYRSNWSNYTPS-QLESSYVSNIHRLFSERVEIFTSVEFTKASII 658
            .|||||::|:  :..|:|:.|.|.. .:|||| .::::.:||||:|||||::||:.|||.|.|::
Zfish   684 HSSDSSKRTF--SVYSSSRQQIRYA-PSYTPSAPMDTNLLSNIHKLFSERIDIFSPVEFNKVSVL 745

  Fly   659 MGIIKIGLKTLLECVRLRTFSKFGLQQIQVDAHYLQMNLWRFVSDENLVNFLLDEILGSAVQRCL 723
            .|||||.|||.|||||||||.::||||||||.|||||.|||||||||||:||||||:|||..|||
Zfish   746 TGIIKISLKTFLECVRLRTFGRYGLQQIQVDCHYLQMYLWRFVSDENLVHFLLDEIVGSAAHRCL 810

  Fly   724 ESVLMEPNAVEIICERG 740
            :...||.:.:|:|||||
Zfish   811 DPSPMEQSVIEVICERG 827

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps51NP_611363.2 Vps51 11..96 CDD:285862 49/85 (58%)
Dor1 50..210 CDD:302817 90/160 (56%)
vps51NP_001036200.1 Vps51 46..131 CDD:285862 49/85 (58%)
Dor1 84..245 CDD:302817 90/161 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293557947
eggNOG 1 0.900 E1_KOG2346
Hieranoid 1 1.000
Homologene 1 1.000 H34675
Inparanoid 1 1.050 603 1.000 Inparanoid score I886
OMA 1 1.010
OrthoDB 1 1.010 D1305393at2759
OrthoFinder 1 1.000 FOG0005305
OrthoInspector 1 1.000 T1052657
orthoMCL 1 0.900 OOG5_130453
Panther 1 1.100 LDO PTHR15954
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2898
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.