DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vps51 and RGD1560544

Sequence 1:NP_611363.2 Gene:Vps51 FlyBaseID:FBgn0034380 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001099798.1 Gene:RGD1560544 RGDID:1560544 Length:139 Species:Rattus norvegicus

Alignment Length:61 Identity:34/62 (55%)
Similarity:47/62 (76%) Gaps:0/62 (0%)


  Fly     7 NPFDMDSSSFDAEKYLERLLKDCSLKQIMDTEAAVVKDTQTLHSDMQTLVYENYNKFISAT 67
            :|.|::.:.||.|.||::|.::|.|.|:||:|..:|:..:.|.||||||||||||||||||
  Rat    59 DPTDLNGAHFDPEVYLDKLRRECPLAQLMDSETDMVRQIRALDSDMQTLVYENYNKFISAT 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vps51NP_611363.2 Vps51 11..96 CDD:285862 32/58 (55%)
Dor1 50..210 CDD:302817 18/19 (95%)
RGD1560544NP_001099798.1 Vps51 63..>119 CDD:285862 31/56 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005305
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.