DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Prp19 and prpf19

Sequence 1:NP_523783.1 Gene:Prp19 FlyBaseID:FBgn0261119 Length:505 Species:Drosophila melanogaster
Sequence 2:NP_001005435.1 Gene:prpf19 XenbaseID:XB-GENE-975233 Length:439 Species:Xenopus tropicalis

Alignment Length:441 Identity:294/442 (67%)
Similarity:358/442 (81%) Gaps:4/442 (1%)


  Fly     1 MALVCALTNEVPETPVVSPHSGAVFEKRVIEKYLLENGCDPISGKELKPEELIEIKTPAVVKPKP 65
            |:|.|.::|||.:.|.:||.||.:|::|:|||||.|||.||::.:.|..::||:||....::|||
 Frog     1 MSLTCYISNEVTDRPCISPVSGHIFDRRLIEKYLAENGTDPVTNQPLSEDQLIDIKVAHPIRPKP 65

  Fly    66 PSATSIPATLKTMQDEWDALMIHSFTQRQQLQTTRQELSHALYQHDAACRVIARLNKEVAAAREA 130
            ||||||||.||::||||||:|:||||.||||||||||||||||||||||||||||.|||.|||||
 Frog    66 PSATSIPAILKSLQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREA 130

  Fly   131 LATLKPQAGIANAPTAIPQPALASEAGGAAAHPM-EQAGMSAEVIQKLQDKATVLTQERKKRGRT 194
            |||||||||| :.|.|.|.|. |..||.|.|..: |..|||||:||||||||||||.||||||:|
 Frog   131 LATLKPQAGI-SVPQASPMPQ-AGAAGSAEAMELGELIGMSAEIIQKLQDKATVLTTERKKRGKT 193

  Fly   195 VPEDLVTTDQVKNFLTVASHPGLHSASVPGILALDINSADHSKILTGGNDKNATVFNKDTEQMVA 259
            ||||||..:::..:..|:||.||||||||||||||:...|.:|.||||.||:..||:..::|::|
 Frog   194 VPEDLVKPEELSKYHQVSSHVGLHSASVPGILALDLCPTDTNKTLTGGADKSVVVFDALSQQILA 258

  Fly   260 ILKGHTKKITKVIYHPNEDTVITGSPDMNIRIWHVPTSQTQLLLRCHEGPVTGLSLHPTGDYLLS 324
            .|||||||:|.|::||:::.|.:.|||..||:|.||.:....:||.|||.|||||||.|||||||
 Frog   259 TLKGHTKKVTSVVFHPSQELVFSASPDSTIRVWSVPDASCAQVLRAHEGAVTGLSLHATGDYLLS 323

  Fly   325 TSSDKHWAFSDIRTGRLLTKVID-TAEVGLTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSNVANF 388
            .|.|::||||||..||:||||.| ::...||.||||||||||||||||||:|||||||:||||||
 Frog   324 CSDDQYWAFSDIHVGRVLTKVTDESSGCALTCAQFHPDGLIFGTGTVDSQIKIWDLKERSNVANF 388

  Fly   389 PGHTGPISAISFSENGYYLATAADDACVKLWDLRKLKNFKTIQLDDGYEVK 439
            |||:||:|.|:||||||||||||||:.||||||||||||||:||::||:|:
 Frog   389 PGHSGPVSCIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLEEGYQVQ 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Prp19NP_523783.1 Ubox 2..68 CDD:128780 32/66 (48%)
Prp19 69..132 CDD:285771 55/63 (87%)
WD40 210..503 CDD:238121 156/232 (67%)
WD40 <225..505 CDD:225201 144/217 (66%)
WD40 repeat 269..305 CDD:293791 15/36 (42%)
WD40 repeat 310..345 CDD:293791 27/35 (77%)
WD40 repeat 354..389 CDD:293791 32/35 (91%)
WD40 repeat 395..431 CDD:293791 30/36 (83%)
WD40 repeat 438..484 CDD:293791 1/3 (33%)
prpf19NP_001005435.1 Ubox 5..68 CDD:128780 31/63 (49%)
Prp19 69..132 CDD:285771 55/63 (87%)
WD40 <211..430 CDD:225201 150/219 (68%)
WD40 217..431 CDD:238121 146/214 (68%)
WD40 repeat 224..262 CDD:293791 19/38 (50%)
WD40 repeat 268..304 CDD:293791 15/36 (42%)
WD40 repeat 309..344 CDD:293791 27/35 (77%)
WD40 repeat 354..389 CDD:293791 32/35 (91%)
WD40 repeat 395..434 CDD:293791 32/39 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C296394462
eggNOG 1 0.900 E1_KOG0289
Hieranoid 1 1.000
Homologene 1 1.000 H6421
Inparanoid 1 1.050 591 1.000 Inparanoid score I894
OMA 1 1.010
OrthoDB 1 1.010 D1049599at2759
OrthoFinder 1 1.000 FOG0004397
OrthoInspector 1 1.000 T1059182
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R276
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.