DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ttd14 and unc-132

Sequence 1:NP_001097366.1 Gene:Ttd14 FlyBaseID:FBgn0284257 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_504030.2 Gene:unc-132 WormBaseID:WBGene00021078 Length:501 Species:Caenorhabditis elegans

Alignment Length:491 Identity:205/492 (42%)
Similarity:279/492 (57%) Gaps:74/492 (15%)


  Fly     9 QQSVMASTSNGQEQQR----------HQDEPEQQQQVEIRKSSSPKPGAMPSLKLNRMGSVSPKD 63
            :||.|:||.......|          :.:...||.|...:...||       :|.....||| .:
 Worm    46 RQSSMSSTVAAASASRRVSPIYPKMNNNNNNHQQNQHHRKYRVSP-------VKTTCSRSVS-LE 102

  Fly    64 KRVYKIVLTGGPCGGKTTGQSRLCTFFENLGWKVFRVPETATVLLSGGVKFSDL-TEKEDPPTPT 127
            ::||||||||||||||||.|.||.|||||||||||.||||||:||.|.||||:| ||        
 Worm   103 RKVYKIVLTGGPCGGKTTAQVRLATFFENLGWKVFTVPETATILLGGRVKFSELDTE-------- 159

  Fly   128 TFVYKDLPFAAPEHSLIDLTASCPRCLAKAASRPNGSEAYKFQENLIRTMVQIENTYFELGNS-S 191
                                                 ::|.||.:|:.||.|||||:|...:: .
 Worm   160 -------------------------------------QSYIFQRDLLATMHQIENTFFNQASAIK 187

  Fly   192 NRNCLIICDRGVMDASAYISKDKWEKMMAGNNWNPVEMRDNRYNQILHLVSAANGAEDFYSTEDH 256
            :||.|||||||.||.|||.|.:.|::|:...|:...::|.:||:||.|||:||:|||.:|:..::
 Worm   188 DRNVLIICDRGCMDPSAYSSPEDWQRMLKDLNYEEFDLRCSRYDQIAHLVTAADGAEKYYTLANN 252

  Fly   257 ACRSEGVDLARELDYKSAAAWVGHPYFDVID--NSTNFETKMNRMIESVCQKLGIDIGDRLQATS 319
            |.|||||..|.|||.::.:.|:||||.|:||  |::.|:.|:|::|:.||.:.||..||||...|
 Worm   253 ATRSEGVSHAMELDKRTRSVWIGHPYMDIIDNKNTSTFDDKVNKLIQVVCDRTGIRSGDRLAKDS 317

  Fly   320 RKLKYLVALLPPD-SEFPPFQDFDVVHHYLQSAGPKVQARLRKRGQKNHWSYIHTQRRPNVHGQA 383
            :|.|:||:.:  | ..|..|::||:.|.||.|....:|.|.|:|.|.|..:|..|.|......:.
 Worm   318 KKRKWLVSAV--DWKNFGKFEEFDIEHFYLLSDESNIQHRFRRRTQNNRSTYTLTSREYFKESKD 380

  Fly   384 RIEVKTQLTHRDYMNLLAQRDDAHFTIYKKRRCFLINNQYFQLDIYKEPGHPRCKG--LVLLETY 446
            .||.:..:..|||......||.:..:||||||||:..|.||.:|||.:|..|:..|  |:.||||
 Worm   381 SIETRMNVLSRDYNTYANMRDKSRASIYKKRRCFMYGNMYFNMDIYSDPLPPQANGNHLIFLETY 445

  Fly   447 SSLT-GDAL-KNCMPKFLNIVKEVTGDPDYSMFNLS 480
            :::. |..| :..||.||.|.||:|||..|||::||
 Worm   446 TTVVKGTPLPEGSMPPFLTIEKEITGDSQYSMYSLS 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ttd14NP_001097366.1 AAA_28 68..293 CDD:290255 108/229 (47%)
CYTH-like_Pase 323..481 CDD:299847 67/164 (41%)
unc-132NP_504030.2 AAA_28 107..285 CDD:290255 106/223 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139743435
eggNOG 1 0.900 E1_28P3U
Hieranoid 1 1.000
Homologene 1 1.000 H16204
Inparanoid 1 1.050 341 1.000 Inparanoid score I1371
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0013875
OrthoInspector 1 1.000 T475448
orthoMCL 1 0.900 OOG5_135037
Panther 1 1.100 LDO PTHR34932
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R16927
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.