DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE7 and GstE12

Sequence 1:NP_611329.1 Gene:GstE7 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster

Alignment Length:217 Identity:100/218 (46%)
Similarity:132/218 (61%) Gaps:6/218 (3%)


  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65
            |.|..||....|||.|||.||..|:.:..|...:|....|:.:.||||.|||||:|||.|....|
  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65

  Fly    66 WDSHAIIAYLVSKYG-KTDSLYPKDLLQRAVVDQRLHFESGVIFANALRSITKPL--FAGKQTMI 127
            .|||||.||||.||| |...||||:|:|||.||.|||.:||.:||. ||.:.:|:  :......|
  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFAR-LRFLYEPILYYGSTDCSI 129

  Fly   128 PKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFKRL 192
            .|..|  |.:.::.||.||....|:.|:.||||||..::||:|:.....:|..|:|::.||.|||
  Fly   130 DKIAY--IQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRL 192

  Fly   193 QKLPYYEEANGNGARTFESFIR 214
            .:||||:|.||:||...:|..:
  Fly   193 AELPYYQEVNGDGADELKSIFK 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE7NP_611329.1 GstA 4..196 CDD:223698 89/195 (46%)
GST_N_Delta_Epsilon 4..77 CDD:239343 37/73 (51%)
GST_C_Delta_Epsilon 91..209 CDD:198287 51/120 (43%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 37/73 (51%)
GstA 6..201 CDD:223698 93/198 (47%)
GST_C_Delta_Epsilon 92..210 CDD:198287 51/121 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134647477
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.