DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE6 and GstD2

Sequence 1:NP_611328.1 Gene:GstE6 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:201 Identity:76/202 (38%)
Similarity:119/202 (59%) Gaps:9/202 (4%)


  Fly    16 RAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYA 80
            |.|.:...||.|......::.:...||.||:::.|||||:|||.|:|..||:|.||..|||.||.
  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77

  Fly    81 DSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSV--LFQGQTKVPKERYDAIIEIYDFVE 143
            ..|.|.|.||.||||::|||:|:.|.::    .|.:|..  ||:.......|....|...:.|::
  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLY----ESFAKYYYPLFRTGKPGSDEDLKRIETAFGFLD 138

  Fly   144 TFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQL-PYYEEANGKGVR 207
            |||:||:|:||:|||:||.:::|:|::.|. ...|.:||..:..|....::: |.::| |.:|:.
  Fly   139 TFLEGQEYVAGDQLTVADIAILSTVSTFEV-SEFDFSKYSNVSRWYDNAKKVTPGWDE-NWEGLM 201

  Fly   208 QLVAIF 213
            .:.|:|
  Fly   202 AMKALF 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 70/183 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/61 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 40/121 (33%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 27/61 (44%)
GST_C_Delta_Epsilon 88..204 CDD:198287 40/122 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92092788
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.