DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE6 and GstE12

Sequence 1:NP_611328.1 Gene:GstE6 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster

Alignment Length:215 Identity:95/216 (44%)
Similarity:136/216 (63%) Gaps:2/216 (1%)


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYI 65
            |.|..||....|||.|||.||..|:.|..|...::::....|:||:|:.|||||:|||.|....|
  Fly     1 MSKPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEATI 65

  Fly    66 WDSHAIIAYLVSKYADSD-ALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPK 129
            .|||||.||||.||...: .||||:.::||.||.|||.:||.:||. :|.:.:.:|:.|.|....
  Fly    66 IDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFAR-LRFLYEPILYYGSTDCSI 129

  Fly   130 ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQ 194
            ::...|.:.::.:|.|||.|.|:.|:.||||||..|::|.|:.....:|..|:|::.||:|:|.:
  Fly   130 DKIAYIQKCWEILEGFLKDQPYLCGSDLTIADFCAVATVTSVNDTAPIDEFKFPKMHAWLKRLAE 194

  Fly   195 LPYYEEANGKGVRQLVAIFK 214
            ||||:|.||.|..:|.:|||
  Fly   195 LPYYQEVNGDGADELKSIFK 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 82/193 (42%)
GST_N_Delta_Epsilon 4..77 CDD:239343 36/73 (49%)
GST_C_Delta_Epsilon 91..209 CDD:198287 47/118 (40%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 36/73 (49%)
GstA 6..201 CDD:223698 86/196 (44%)
GST_C_Delta_Epsilon 92..210 CDD:198287 48/119 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134647491
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.