DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE6 and GstE13

Sequence 1:NP_611328.1 Gene:GstE6 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster

Alignment Length:211 Identity:76/212 (36%)
Similarity:122/212 (58%) Gaps:3/212 (1%)


  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLED-DGHY 64
            |.|.|||....|||.||..|....:.|..|...||...:..||.|:::.||||.:|...| ||..
  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65

  Fly    65 IWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPK 129
            ..|||||:.:||:|||.:|.|||:|..:||.:|.|:|:|:||:| ..::.|....::.|:.:...
  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLF-QVVKDIVARNIYGGEGEYNP 129

  Fly   130 ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQ 194
            .........|..:|.||:...::.||:|::||.|:.:::.:|:..:.::..|||:...|::::::
  Fly   130 RSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDK 194

  Fly   195 -LPYYEEANGKGVRQL 209
             ||..||.|.||.|.|
  Fly   195 LLPDNEEINLKGARAL 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 66/194 (34%)
GST_N_Delta_Epsilon 4..77 CDD:239343 31/74 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/119 (29%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 31/74 (42%)
GST_C_Delta_Epsilon 92..211 CDD:198287 35/121 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134647647
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.