DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE5 and GstD2

Sequence 1:NP_611327.1 Gene:GstE5 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524912.1 Gene:GstD2 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster

Alignment Length:205 Identity:76/206 (37%)
Similarity:112/206 (54%) Gaps:19/206 (9%)


  Fly    16 RAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYA 80
            |.|.:...||.|......:|....|||..|::|.||:||:|||.|:|..||:|.||..|||.||.
  Fly    13 RTVIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77

  Fly    81 DSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNG-------LNRIPKERYDAIVEI 138
            ..|.|.|.|..:|||::|||:|:.|.::.:..| ...|||..|       |.||.        ..
  Fly    78 KDDYLLPNDPKKRAVINQRLYFDMGTLYESFAK-YYYPLFRTGKPGSDEDLKRIE--------TA 133

  Fly   139 YDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKL-PYYEEAN 202
            :.|::|||.|.:|:||||||:||.:::|:: |.....|.|..||..:..|....:|: |.::| |
  Fly   134 FGFLDTFLEGQEYVAGDQLTVADIAILSTV-STFEVSEFDFSKYSNVSRWYDNAKKVTPGWDE-N 196

  Fly   203 AKGARELETI 212
            .:|...::.:
  Fly   197 WEGLMAMKAL 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 72/188 (38%)
Thioredoxin_like 4..77 CDD:294274 28/61 (46%)
GST_C_Delta_Epsilon 91..209 CDD:198287 42/126 (33%)
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 28/61 (46%)
GST_C_Delta_Epsilon 88..204 CDD:198287 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92092617
eggNOG 1 0.900 E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43969
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.