DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and URE2

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae

Alignment Length:241 Identity:61/242 (25%)
Similarity:96/242 (40%) Gaps:60/242 (25%)


  Fly     5 TLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNG---FYLA 66
            ||:....:|....|.:.|..|...::...::....||..|||:.:||...||||.|:|   ..:.
Yeast   115 TLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIW 179

  Fly    67 DSHAINSYLVSKYGR---NDSLYPKDLKKRAIVDQRLHYDSS-VVTSTGRAITFPLFWENKTEIP 127
            :|.||..:||:||.:   |..|:..||..::.::..|.:.:| .....|:|:.|..|...|....
Yeast   180 ESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASA 244

  Fly   128 QAR-IDALEGVY-----------KSLNLFLENGN---------------------YLAGDNLTIA 159
            ..| .|.:..||           ::|.:.|:..|                     :|.||.||||
Yeast   245 VERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIA 309

  Fly   160 DFHVIAGLTGFFVFLP----VD------ATKYPELAAWIKRIKELP 195
            |          ..|:|    ||      ..::||:..|.|.:...|
Yeast   310 D----------LAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRP 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 60/240 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/75 (32%)
GST_C_Delta_Epsilon 91..208 CDD:198287 31/150 (21%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 26/79 (33%)
GST_C_Ure2p 208..350 CDD:198326 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.