DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and GSTF9

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana

Alignment Length:210 Identity:55/211 (26%)
Similarity:96/211 (45%) Gaps:20/211 (9%)


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |.:||...:.|.|: |:||....:.|:...|:||:.||.:|.:|.:.|..||||:.|..:.:.:|
plant     3 LKVYGPHFASPKRA-LVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFES 66

  Fly    69 HAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIP----- 127
            .|:..|:..|| .:...|..|.::.|..|:|.|..:::........:|..:.:.:....|     
plant    67 RAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKL 131

  Fly   128 -QARIDALEGVYKSLNLFLENGNYLAGDNLTIADF-HVIAGLTGFFV------FLPVDATKYPEL 184
             :...:.|.||.......|....|||||.:::||. |:  ..|.:.|      ::..|.   ..:
plant   132 IKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHL--PFTDYLVGPIGKAYMIKDR---KHV 191

  Fly   185 AAWIKRIKELPYYEE 199
            :||...|...|.::|
plant   192 SAWWDDISSRPAWKE 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 53/205 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/123 (21%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 55/211 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2329
OMA 1 1.010
OrthoDB 1 1.010 D1231780at2759
OrthoInspector 1 1.000 T32125
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.