DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and gstt1a

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio

Alignment Length:218 Identity:71/219 (32%)
Similarity:108/219 (49%) Gaps:29/219 (13%)


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |.||....|.|.|||.:..:...:.|:||.|:|...|....||.|::.:..||||.|..|.|.:|
Zfish     3 LELYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTES 67

  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW-------ENKTEI 126
            .||..||..|:...|..||.||:|||.||:.|.:..:.:.|.|..:    ||       .....:
Zfish    68 IAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKV----FWFKGVLPAVTGAPV 128

  Fly   127 PQARID-ALEGVYKSLNL----FLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKY 181
            |:.::| |||.:..||.:    ||::..::.||.:::||...|..:     ||..||     ...
Zfish   129 PKEKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVATGVDVF-----EGR 188

  Fly   182 PELAAWIKRIKE---LPYYEEAN 201
            |.|:||..|:|:   :..::||:
Zfish   189 PALSAWRDRVKKEVGVELFDEAH 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 69/211 (33%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/73 (40%)
GST_C_Delta_Epsilon 91..208 CDD:198287 36/132 (27%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 68/205 (33%)
GST_N_Theta 3..78 CDD:239348 30/75 (40%)
GST_C_Theta 91..217 CDD:198292 36/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1231780at2759
OrthoFinder 1 1.000 FOG0000104
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127168
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.