DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GstE3 and eef1g

Sequence 1:NP_611325.2 Gene:GstE3 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_012809037.1 Gene:eef1g XenbaseID:XB-GENE-975013 Length:438 Species:Xenopus tropicalis

Alignment Length:222 Identity:60/223 (27%)
Similarity:86/223 (39%) Gaps:44/223 (20%)


  Fly     9 IDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDN-GFYLADSHAIN 72
            :..|||             :|.:.:.|...      ||||..||..|||.:.| ||.|.:|.||.
 Frog    31 VASSPP-------------EFQFGVTNKTS------EFLKKFPLGKVPAFEGNDGFCLFESSAIA 76

  Fly    73 SYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFP---LFWENKTEIPQAR--ID 132
            .|:     .||.|...:...:|.|.|.|.:..|.:.....|..||   :...||....||:  |.
 Frog    77 HYV-----GNDELRGTNRLHQAQVIQWLSFSDSHIVPPASAWVFPTLGIMQYNKQATEQAKEEIK 136

  Fly   133 ALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFF--VFLPVDATKYPELAAWIKRIKELP 195
            |:.||   |:..|:...:|.|:.:|:||..|...|...:  |..|.....:..:..|.......|
 Frog   137 AVLGV---LDSHLKTRTFLVGERVTLADIAVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQP 198

  Fly   196 YYEEANG-----SRAAQIIEFIKSKKF 217
            .:....|     .:.||    ..:|||
 Frog   199 EFRAVLGEVKLCDKMAQ----FDAKKF 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 53/194 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 91..208 CDD:198287 32/129 (25%)
eef1gXP_012809037.1 GST_N_EF1Bgamma 4..82 CDD:239342 23/75 (31%)
GstA 5..203 CDD:223698 54/199 (27%)
GST_C_EF1Bgamma_like 92..213 CDD:198290 30/124 (24%)
EF1G 276..382 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.